(data stored in SCRATCH3701 zone)

EMBL: AE017197.PPNK

AE017197.PPNK        Location/Qualifiers
FT   CDS             complement(538134..538901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppnK"
FT                   /locus_tag="RT0427"
FT                   /product="DPN kinase"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:RT0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03904"
FT                   /db_xref="GOA:Q68WT8"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WT8"
FT                   /protein_id="AAU03904.1"
FT                   /translation="MNTNKIALIYNKNSKHLAIIEEIKKLFNYCKIEDAEVIIIIGGDG
FT                   ELLHNIHRYMHLNIPFYGLNLGSLGFLMNPLDTKKLLQNIYESTVSVLNPLLMQAEDTN
FT                   GQIYKALAINEVSIFRKTNQAAKFRIDINGVERMSELVADGALVATPAGSSAYNLSAGG
FT                   PILPLASNMLCLTPICSFRPRRWHGALLLSSATIKFEILNITKRPVNATADFQEFNNIT
FT                   RVTVKSTKDQHIKLLFNKNHTLEDRIIKEQFGE"
     MNTNKIALIY NKNSKHLAII EEIKKLFNYC KIEDAEVIII IGGDGELLHN IHRYMHLNIP        60
     FYGLNLGSLG FLMNPLDTKK LLQNIYESTV SVLNPLLMQA EDTNGQIYKA LAINEVSIFR       120
     KTNQAAKFRI DINGVERMSE LVADGALVAT PAGSSAYNLS AGGPILPLAS NMLCLTPICS       180
     FRPRRWHGAL LLSSATIKFE ILNITKRPVN ATADFQEFNN ITRVTVKSTK DQHIKLLFNK       240
     NHTLEDRIIK EQFGE                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page