(data stored in SCRATCH3701 zone)

EMBL: AE017197.PRSA

AE017197.PRSA        Location/Qualifiers
FT   CDS             732792..733652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="RT0565"
FT                   /product="protein export protein PrsA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04032"
FT                   /db_xref="GOA:Q68WG0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WG0"
FT                   /protein_id="AAU04032.1"
FT                   /translation="MMSHMKKLSVIFLSVSMLSSIAFCDQDKVVATYKGGEVKESQIMQ
FT                   EFKPQLNLQSGETIKNFDDFPLQDQEKLIKIYVNNLLLKEEVAKSSITSSKEFQEKLEN
FT                   AKNQLAQQELLANYIKSNITDKMFDDEYNKYVDNLKGKEQIKVAHILVKSQKEANTVKT
FT                   KLSKGGNFNKLAEEFSLDKATASNGGVIGYIILNQSGQLVPEFENKAFALKVNEVSTPV
FT                   KTDFGWHIIKVLEKKPVPIPTKKEAKVTIDNILAAEILKKYISDLEAKADLKIMLPKAN
FT                   SKTGS"
     MMSHMKKLSV IFLSVSMLSS IAFCDQDKVV ATYKGGEVKE SQIMQEFKPQ LNLQSGETIK        60
     NFDDFPLQDQ EKLIKIYVNN LLLKEEVAKS SITSSKEFQE KLENAKNQLA QQELLANYIK       120
     SNITDKMFDD EYNKYVDNLK GKEQIKVAHI LVKSQKEANT VKTKLSKGGN FNKLAEEFSL       180
     DKATASNGGV IGYIILNQSG QLVPEFENKA FALKVNEVST PVKTDFGWHI IKVLEKKPVP       240
     IPTKKEAKVT IDNILAAEIL KKYISDLEAK ADLKIMLPKA NSKTGS                      286
//

If you have problems or comments...

PBIL Back to PBIL home page