(data stored in SCRATCH3701 zone)

EMBL: AE017197.RODA

AE017197.RODA        Location/Qualifiers
FT   CDS             complement(342450..343550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="RT0271"
FT                   /product="rod shape determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03751"
FT                   /db_xref="GOA:Q68X91"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X91"
FT                   /protein_id="AAU03751.1"
FT                   /translation="MHKNYLEQLQKLPITLIVLIIVICCIGFIVLYSAANSNLQPWAYK
FT                   QIINFCIFLPLAIIIALIDLRIIFRLSYIFYFCALALLIAVELFGSTAMGGKRWIDLGI
FT                   VKLQPSEPIKISIVLMLARYFHRSTSDDLTKLYKVIIPIIGILTPAFLIIREPDLGTGM
FT                   IVLIVAAIIFFAAGFRIKYFIILALAALISMPIAWNMMYDYQKKRVMVFLDPEHDPLGA
FT                   SYNIIQSKIAIGSGSLFGRGLNQGSQSHLDFLPEHQTDFIFATFAEEFGFIGGMFLLIL
FT                   YFALITISLLIGVNCREIFSKLMVIGITSILFSHVFINIAMVMGLLPVVGVPLPFISYG
FT                   GTMIASMLIGFGLVMNAQIHGHATLN"
     MHKNYLEQLQ KLPITLIVLI IVICCIGFIV LYSAANSNLQ PWAYKQIINF CIFLPLAIII        60
     ALIDLRIIFR LSYIFYFCAL ALLIAVELFG STAMGGKRWI DLGIVKLQPS EPIKISIVLM       120
     LARYFHRSTS DDLTKLYKVI IPIIGILTPA FLIIREPDLG TGMIVLIVAA IIFFAAGFRI       180
     KYFIILALAA LISMPIAWNM MYDYQKKRVM VFLDPEHDPL GASYNIIQSK IAIGSGSLFG       240
     RGLNQGSQSH LDFLPEHQTD FIFATFAEEF GFIGGMFLLI LYFALITISL LIGVNCREIF       300
     SKLMVIGITS ILFSHVFINI AMVMGLLPVV GVPLPFISYG GTMIASMLIG FGLVMNAQIH       360
     GHATLN                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page