(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLB

AE017197.RPLB        Location/Qualifiers
FT   CDS             complement(825599..826420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="RT0648"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:RT0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04111"
FT                   /db_xref="GOA:Q68W81"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W81"
FT                   /protein_id="AAU04111.1"
FT                   /translation="MALKNFNPITPSLRELVQVDKTNLWKGRPLKSLTKGMSKTGGRNQ
FT                   QGRITSWHRGGGHKKLYRVIDFKRKKIDIFAVVERIEYDPNRTAFIALIKYDDGEYSYI
FT                   LAPQKLSIGDRVISSQAADIKIGNCLPLKSIPIGTTLHNVEMKVGKGGQIARSAGTSVE
FT                   LVGKDSGYAQIKLRSGEFRLVPLDCKATIGSISNPDQKNINLGKAGRNRWLGWRPHVRG
FT                   VAMNPIDHPHGGGEGKTSGGRHPVTPWGFSTKGKKTRKNKRTSKFIVKKRK"
     MALKNFNPIT PSLRELVQVD KTNLWKGRPL KSLTKGMSKT GGRNQQGRIT SWHRGGGHKK        60
     LYRVIDFKRK KIDIFAVVER IEYDPNRTAF IALIKYDDGE YSYILAPQKL SIGDRVISSQ       120
     AADIKIGNCL PLKSIPIGTT LHNVEMKVGK GGQIARSAGT SVELVGKDSG YAQIKLRSGE       180
     FRLVPLDCKA TIGSISNPDQ KNINLGKAGR NRWLGWRPHV RGVAMNPIDH PHGGGEGKTS       240
     GGRHPVTPWG FSTKGKKTRK NKRTSKFIVK KRK                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page