(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLL

AE017197.RPLL        Location/Qualifiers
FT   CDS             160038..160415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="RT0128"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:RT0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03613"
FT                   /db_xref="GOA:Q68XM9"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XM9"
FT                   /protein_id="AAU03613.1"
FT                   /translation="MADLAKIEEQLSSLTLMQAAELVKILEAKWGVSAVTPIAVASAGV
FT                   ADPVAEAVAEKTEFEVVLTATGDKKVEVIKIIKDITGLGLIEAKKLVDEAPKPIKSNLK
FT                   KAEAEEIKNKLEATGAKVELK"
     MADLAKIEEQ LSSLTLMQAA ELVKILEAKW GVSAVTPIAV ASAGVADPVA EAVAEKTEFE        60
     VVLTATGDKK VEVIKIIKDI TGLGLIEAKK LVDEAPKPIK SNLKKAEAEE IKNKLEATGA       120
     KVELK                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page