(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLM

AE017197.RPLM        Location/Qualifiers
FT   CDS             290453..290920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="RT0225"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:RT0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03707"
FT                   /db_xref="GOA:Q68XD5"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XD5"
FT                   /protein_id="AAU03707.1"
FT                   /translation="MKTYSAKPSEIEKKWWVIDAKNIVLGRLASRVAIMLRGKHKPSFT
FT                   PHLDCGDNIIIINAEHIKLTGKKLNHKDGKVYYRHTGFPGGIKDTTAGKILSGKYPERV
FT                   IKMAVKRMITRNVLGAKQMSNLYVYANCEHPHMAQQPTVYDFASKNPKNKK"
     MKTYSAKPSE IEKKWWVIDA KNIVLGRLAS RVAIMLRGKH KPSFTPHLDC GDNIIIINAE        60
     HIKLTGKKLN HKDGKVYYRH TGFPGGIKDT TAGKILSGKY PERVIKMAVK RMITRNVLGA       120
     KQMSNLYVYA NCEHPHMAQQ PTVYDFASKN PKNKK                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page