(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLN

AE017197.RPLN        Location/Qualifiers
FT   CDS             complement(822976..823344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="RT0641"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:RT0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04104"
FT                   /db_xref="GOA:Q68W88"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W88"
FT                   /protein_id="AAU04104.1"
FT                   /translation="MIQMQSILEVADNSGAKKVMCIKVLGGSHHMMAKLGDVIVVSIKE
FT                   AIPGGKVKKGDVYKGVIVRTKTGVVRSDGSTIKFDKNALVLLNKQDEPIGTRVFGPVTR
FT                   ELRAKKYVRIMSLAEEVL"
     MIQMQSILEV ADNSGAKKVM CIKVLGGSHH MMAKLGDVIV VSIKEAIPGG KVKKGDVYKG        60
     VIVRTKTGVV RSDGSTIKFD KNALVLLNKQ DEPIGTRVFG PVTRELRAKK YVRIMSLAEE       120
     VL                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page