(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLO

AE017197.RPLO        Location/Qualifiers
FT   CDS             complement(819219..819671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="RT0632"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:RT0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04095"
FT                   /db_xref="GOA:Q68W97"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W97"
FT                   /protein_id="AAU04095.1"
FT                   /translation="MKLNELYNNIGAKKNKKRIARGIGSGKGKTAGRGIKGQKSRSGVA
FT                   IKGFEGGQTPMIKRLPKRGFKCISTKKYNIINIYNIEKALTDGRLSTNNIITKEKLIEI
FT                   GLINNKNLVKLLSICSDDFASPLSLKLDAYSSKAKYLIEKAGGQLL"
     MKLNELYNNI GAKKNKKRIA RGIGSGKGKT AGRGIKGQKS RSGVAIKGFE GGQTPMIKRL        60
     PKRGFKCIST KKYNIINIYN IEKALTDGRL STNNIITKEK LIEIGLINNK NLVKLLSICS       120
     DDFASPLSLK LDAYSSKAKY LIEKAGGQLL                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page