(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLP

AE017197.RPLP        Location/Qualifiers
FT   CDS             complement(823848..824258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="RT0644"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:RT0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04107"
FT                   /db_xref="GOA:Q68W85"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W85"
FT                   /protein_id="AAU04107.1"
FT                   /translation="MLAPKKQKFRKAHKGRVMSKAKAGMTLAFGSFGLKSIDGWRVTAR
FT                   QIEAGRKAATRCMKRQGRLWIRIFPDVPVSKKPAEVRMGKGKGAPEFFAVRVSPGRIMF
FT                   EIEGVEENIALRALELASAKLPVRTRIVRRYE"
     MLAPKKQKFR KAHKGRVMSK AKAGMTLAFG SFGLKSIDGW RVTARQIEAG RKAATRCMKR        60
     QGRLWIRIFP DVPVSKKPAE VRMGKGKGAP EFFAVRVSPG RIMFEIEGVE ENIALRALEL       120
     ASAKLPVRTR IVRRYE                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page