(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLQ

AE017197.RPLQ        Location/Qualifiers
FT   CDS             complement(814945..815358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="RT0626"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:RT0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04089"
FT                   /db_xref="GOA:Q68WA3"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WA3"
FT                   /protein_id="AAU04089.1"
FT                   /translation="MRHRIKGRRLNVTSSHRQSMLANMAVALVMHEQIKTTLPKAKELR
FT                   PYIEAIITKAKKADLTVRRSVLSKIKDKKAVEKIINILGVRYKDRPGGYTRIVKSGFRY
FT                   GDLAPIAYIEFVDRDINAKGKKMYQDASEEIKN"
     MRHRIKGRRL NVTSSHRQSM LANMAVALVM HEQIKTTLPK AKELRPYIEA IITKAKKADL        60
     TVRRSVLSKI KDKKAVEKII NILGVRYKDR PGGYTRIVKS GFRYGDLAPI AYIEFVDRDI       120
     NAKGKKMYQD ASEEIKN                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page