(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLR

AE017197.RPLR        Location/Qualifiers
FT   CDS             complement(820458..820814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="RT0635"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:RT0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04098"
FT                   /db_xref="GOA:Q68W94"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W94"
FT                   /protein_id="AAU04098.1"
FT                   /translation="MRSAKLKFEKRKSRIRHKISRTSNRVRLSVFKSGRHIYAQIIDDS
FT                   KSITIASASTLDKTIKKIKKSHCNVENAIKIGREIAKKANSAGIKEVVFDRGGYKYHGI
FT                   IKALADAAREKITF"
     MRSAKLKFEK RKSRIRHKIS RTSNRVRLSV FKSGRHIYAQ IIDDSKSITI ASASTLDKTI        60
     KKIKKSHCNV ENAIKIGREI AKKANSAGIK EVVFDRGGYK YHGIIKALAD AAREKITF         118
//

If you have problems or comments...

PBIL Back to PBIL home page