(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLV

AE017197.RPLV        Location/Qualifiers
FT   CDS             complement(824928..825287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="RT0646"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:RT0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04109"
FT                   /db_xref="GOA:Q68W83"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W83"
FT                   /protein_id="AAU04109.1"
FT                   /translation="MIQENKNFATAKAKSIRVSPRKLNLVASFIRNMKVSEALIQLTFS
FT                   PKRIAKIVKDCLRSAVANAENNLGLDIDRLIITKATVGKSVVMKRIMPRAKGRATRINK
FT                   FFSNLDITVTEKEDN"
     MIQENKNFAT AKAKSIRVSP RKLNLVASFI RNMKVSEALI QLTFSPKRIA KIVKDCLRSA        60
     VANAENNLGL DIDRLIITKA TVGKSVVMKR IMPRAKGRAT RINKFFSNLD ITVTEKEDN        119
//

If you have problems or comments...

PBIL Back to PBIL home page