(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPLW

AE017197.RPLW        Location/Qualifiers
FT   CDS             complement(826421..826717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="RT0649"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:RT0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04112"
FT                   /db_xref="GOA:Q68W80"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W80"
FT                   /protein_id="AAU04112.1"
FT                   /translation="MSVYKYYDLIKKPIITEKTTSISEQNKYTFYVNKFAKKLTIKKAI
FT                   EAIFKVKVKKVNILNIQGKKKRFKGIIGTQINQKKAIVTLEKDHNIDYAGGIK"
     MSVYKYYDLI KKPIITEKTT SISEQNKYTF YVNKFAKKLT IKKAIEAIFK VKVKKVNILN        60
     IQGKKKRFKG IIGTQINQKK AIVTLEKDHN IDYAGGIK                                98
//

If you have problems or comments...

PBIL Back to PBIL home page