(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPMB

AE017197.RPMB        Location/Qualifiers
FT   CDS             complement(49441..49734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="RT0038"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:RT0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03525"
FT                   /db_xref="GOA:Q68XW7"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XW7"
FT                   /protein_id="AAU03525.1"
FT                   /translation="MSRKCELTGVSVLYGNNVSHSQRKTRRRFEPNLRSVKFRSDITDE
FT                   VYRLSVNARCIRSVEKAGGFDEYILKANNDVLSSTARAIKQKIIDIKAVESL"
     MSRKCELTGV SVLYGNNVSH SQRKTRRRFE PNLRSVKFRS DITDEVYRLS VNARCIRSVE        60
     KAGGFDEYIL KANNDVLSST ARAIKQKIID IKAVESL                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page