(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPME

AE017197.RPME        Location/Qualifiers
FT   CDS             complement(49208..49444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="RT0037"
FT                   /product="50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:RT0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03524"
FT                   /db_xref="GOA:Q68XW8"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XW8"
FT                   /protein_id="AAU03524.1"
FT                   /translation="MKNGIHPEYKKLLIKVGSNIFETMSTHPIGEILMDVDFRKHPAWN
FT                   KDSGNVVNQSNKSVSDFNKRFSGLSFDSKKEAS"
     MKNGIHPEYK KLLIKVGSNI FETMSTHPIG EILMDVDFRK HPAWNKDSGN VVNQSNKSVS        60
     DFNKRFSGLS FDSKKEAS                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page