(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPMJ

AE017197.RPMJ        Location/Qualifiers
FT   CDS             complement(568342..568467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="RT0443"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:RT0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03919"
FT                   /db_xref="GOA:Q68WS3"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WS3"
FT                   /protein_id="AAU03919.1"
FT                   /translation="MKVVSSLKSLKKRDKDCQIVKRRGKIFVINKKNKRFRAKQG"
     MKVVSSLKSL KKRDKDCQIV KRRGKIFVIN KKNKRFRAKQ G                            41
//

If you have problems or comments...

PBIL Back to PBIL home page