(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPSA

AE017197.RPSA        Location/Qualifiers
FT   CDS             complement(646852..648558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="RT0508"
FT                   /product="30S ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03978"
FT                   /db_xref="GOA:Q68WL4"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WL4"
FT                   /protein_id="AAU03978.1"
FT                   /translation="MSIKLKQRFVPQLAAINYQFEEDFSKMLKTVDTSHIKEKTVVKGQ
FT                   VIEIKNDMIIVDVGLKNEGRIPKSEFLSLPEVGDVVEVFIEKIEGRNGRTILSREKAVK
FT                   EELWGQLEIMCSKGEFVDGTIFGRVKGGFTVDLSGVVAFLPGSQVDVRPIKDPTSIMNI
FT                   KQPFKILSMDKKLGNIVVSRRVILEESRSEARDEMLSKIKEGMILEGVVKNITDYGAFI
FT                   DLGSVDGLLHLTDISWGRVNHPSEVLEFNQKVKVMVIKFDEKTKRISLGIKQLDSNPWD
FT                   AIKEEFPVGKKMTGKVTNFADYGVFLELKDGLEGLVHSSEISWLKSNQNPRKMLTIGQE
FT                   VEFIVLEVDTEKHRVSLSIKQCQENPLIKFAENNPIGTIIKAPIRNITDFGIFVVLGNN
FT                   MDGMIHEGDISWEDNGTDLLKSYKKGDEIECKVLAINFEKEQVSLGIKQLSPNPYQKIS
FT                   DEYKKGTIVKAVVTEIKDDGLVVLLNNKVTGFIKRVELSDEKDEQKPEMFQVDEEIDAK
FT                   VVSIEKSTGRVLLSVKAHKIAERQKTLKEYGSSDNTTNMGDILANVLEEKK"
     MSIKLKQRFV PQLAAINYQF EEDFSKMLKT VDTSHIKEKT VVKGQVIEIK NDMIIVDVGL        60
     KNEGRIPKSE FLSLPEVGDV VEVFIEKIEG RNGRTILSRE KAVKEELWGQ LEIMCSKGEF       120
     VDGTIFGRVK GGFTVDLSGV VAFLPGSQVD VRPIKDPTSI MNIKQPFKIL SMDKKLGNIV       180
     VSRRVILEES RSEARDEMLS KIKEGMILEG VVKNITDYGA FIDLGSVDGL LHLTDISWGR       240
     VNHPSEVLEF NQKVKVMVIK FDEKTKRISL GIKQLDSNPW DAIKEEFPVG KKMTGKVTNF       300
     ADYGVFLELK DGLEGLVHSS EISWLKSNQN PRKMLTIGQE VEFIVLEVDT EKHRVSLSIK       360
     QCQENPLIKF AENNPIGTII KAPIRNITDF GIFVVLGNNM DGMIHEGDIS WEDNGTDLLK       420
     SYKKGDEIEC KVLAINFEKE QVSLGIKQLS PNPYQKISDE YKKGTIVKAV VTEIKDDGLV       480
     VLLNNKVTGF IKRVELSDEK DEQKPEMFQV DEEIDAKVVS IEKSTGRVLL SVKAHKIAER       540
     QKTLKEYGSS DNTTNMGDIL ANVLEEKK                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page