(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPSH

AE017197.RPSH        Location/Qualifiers
FT   CDS             complement(821372..821770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="RT0637"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:RT0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04100"
FT                   /db_xref="GOA:Q68W92"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W92"
FT                   /protein_id="AAU04100.1"
FT                   /translation="MSMTDNVADMLTRIRNAYKSKLINVSFPSSKIKNSILDVLQKEGY
FT                   IKDYVITQKNNISYTKVALKYSINGEASICEIRRVSKPGKRVYSAIKDLKGYYNNMGIY
FT                   ILSTPYGVMSDREAHIKNVGGEVICKVF"
     MSMTDNVADM LTRIRNAYKS KLINVSFPSS KIKNSILDVL QKEGYIKDYV ITQKNNISYT        60
     KVALKYSING EASICEIRRV SKPGKRVYSA IKDLKGYYNN MGIYILSTPY GVMSDREAHI       120
     KNVGGEVICK VF                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page