(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPSJ

AE017197.RPSJ        Location/Qualifiers
FT   CDS             complement(828225..828542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="RT0652"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:RT0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04115"
FT                   /db_xref="GOA:Q68W77"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W77"
FT                   /protein_id="AAU04115.1"
FT                   /translation="MKNKIKIRLKSFDHRSLDQATKEIVSAVKRTFATINGPIPLPRKI
FT                   ERFTVNRSPHVHKKSREQFEIRKHKRLLVIDDPNPAVVDALSKVDLAAGVDVVIELENG
FT                   E"
     MKNKIKIRLK SFDHRSLDQA TKEIVSAVKR TFATINGPIP LPRKIERFTV NRSPHVHKKS        60
     REQFEIRKHK RLLVIDDPNP AVVDALSKVD LAAGVDVVIE LENGE                       105
//

If you have problems or comments...

PBIL Back to PBIL home page