(data stored in SCRATCH3701 zone)

EMBL: AE017197.RPSS

AE017197.RPSS        Location/Qualifiers
FT   CDS             complement(825296..825574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="RT0647"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:RT0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04110"
FT                   /db_xref="GOA:Q68W82"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W82"
FT                   /protein_id="AAU04110.1"
FT                   /translation="MARSIWKGPFVDGYLIKKVQKLMKSGKSEMIKTWSRRSTILPLFV
FT                   GFTFSVHNGNKFIPVYINEEMVGRKLGEFAPTRTFHGHGADKKVKRK"
     MARSIWKGPF VDGYLIKKVQ KLMKSGKSEM IKTWSRRSTI LPLFVGFTFS VHNGNKFIPV        60
     YINEEMVGRK LGEFAPTRTF HGHGADKKVK RK                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page