(data stored in SCRATCH3701 zone)

EMBL: AE017197.SCA1

AE017197.SCA1        Location/Qualifiers
FT   CDS             14663..18055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sca1"
FT                   /locus_tag="RT0015"
FT                   /product="190 kDa antigen precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03504"
FT                   /db_xref="GOA:Q68XY8"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XY8"
FT                   /protein_id="AAU03504.1"
FT                   /translation="MNKLTEQNLLKKSRFLKYSLLASISVGAVMAMPVEGIAMGIDKKA
FT                   FCTELNTKLLLKFSQSSVNKDTISTTQETNNNLSNNVQSNKSDMTEEVANVTTESLCKV
FT                   SKMQAPEFKASENKFLNTLDFQTLSQELDRNSYTTKPIPQKPEIMLTTSSTTTSMGSNS
FT                   FVNISSASSLKPVTPQQSAPDFKPNYSLGSNTPINIKELSFSSEQQQIAQHSNSTIPLM
FT                   PTTSLVLPVKKSSVEIAPEMVNNISRVDDTVSIKSSEVTEDIKGTKGKKNKKILANQFN
FT                   KSIGSWSKKTGKNKYELNKDSSKIEKFRKDLTTKNKDTDRLSAEIDISETKVSAFQAQQ
FT                   ARIDEAHRDLLNPNQQKAPGKRLEENKTKGKVIKAAVDGVQKIFNNAKKKISRTKLKKL
FT                   QDQVGNHVIIGTSTIPNPLLISKPTMQFSNKLNGTLLEDEDGYLVPCEAQPQIYTVILP
FT                   GQEIENHKSMDSDLLSLSTKTLGKEIDEVHPNIGLSSEKEIEAKLVEDETTYSQDVQNA
FT                   INILNTTNDKNTARLFGQHNNKLTLDLHDNDRKKYYETHKQLSNSIRSPKSDLTTNSSL
FT                   ASSLNIFGSNEDLSWDNAGDIGVGYRYGDEYSCPTPDDKSSSKLIDISDKNTTKVKGLE
FT                   EGITMYDSIDLVADSLKSNAVSFKERNEALKQLSTAISETVISLSESNVQEDAEDILDG
FT                   SILQAMLNSNNDKSIESLSLGSKEQEETEAGIRKAGDKQLLPVPVLLSDCKENEYLSLD
FT                   NYNKGEKNYDSDFKEEEETIEQLSNSDWYKMTKADTAILLEQEAKQEMQTQISENAPTL
FT                   NQAKVINTIVNNMIRNRLDTFINMVVVGAGDEEESNIKRGLWMRAMYGTNNHGRVNNMT
FT                   GYRGINKGATVGFDAKINNNIIGIAYSNVHSVFKFKNSKNNDKELIGSKVISIYGQKEL
FT                   QQNFTLQVLVSASKNFIKDKINYSYGDTKIRSNVKHHNHSYNAEALLNYNYLVKNSIIV
FT                   TPNIGLRYGKSRDGIYNETGINVQKIALTMKENNILSGILGTKVQVSLRDVLKFNNLGL
FT                   TFQAAVEHNFEEKTQRINRVVKIFDNIFKQDYLIPKQPKTSYNLGTGIIFGINNTNISV
FT                   DYNYYLNKHYRSHQGSVKIKVNL"
     MNKLTEQNLL KKSRFLKYSL LASISVGAVM AMPVEGIAMG IDKKAFCTEL NTKLLLKFSQ        60
     SSVNKDTIST TQETNNNLSN NVQSNKSDMT EEVANVTTES LCKVSKMQAP EFKASENKFL       120
     NTLDFQTLSQ ELDRNSYTTK PIPQKPEIML TTSSTTTSMG SNSFVNISSA SSLKPVTPQQ       180
     SAPDFKPNYS LGSNTPINIK ELSFSSEQQQ IAQHSNSTIP LMPTTSLVLP VKKSSVEIAP       240
     EMVNNISRVD DTVSIKSSEV TEDIKGTKGK KNKKILANQF NKSIGSWSKK TGKNKYELNK       300
     DSSKIEKFRK DLTTKNKDTD RLSAEIDISE TKVSAFQAQQ ARIDEAHRDL LNPNQQKAPG       360
     KRLEENKTKG KVIKAAVDGV QKIFNNAKKK ISRTKLKKLQ DQVGNHVIIG TSTIPNPLLI       420
     SKPTMQFSNK LNGTLLEDED GYLVPCEAQP QIYTVILPGQ EIENHKSMDS DLLSLSTKTL       480
     GKEIDEVHPN IGLSSEKEIE AKLVEDETTY SQDVQNAINI LNTTNDKNTA RLFGQHNNKL       540
     TLDLHDNDRK KYYETHKQLS NSIRSPKSDL TTNSSLASSL NIFGSNEDLS WDNAGDIGVG       600
     YRYGDEYSCP TPDDKSSSKL IDISDKNTTK VKGLEEGITM YDSIDLVADS LKSNAVSFKE       660
     RNEALKQLST AISETVISLS ESNVQEDAED ILDGSILQAM LNSNNDKSIE SLSLGSKEQE       720
     ETEAGIRKAG DKQLLPVPVL LSDCKENEYL SLDNYNKGEK NYDSDFKEEE ETIEQLSNSD       780
     WYKMTKADTA ILLEQEAKQE MQTQISENAP TLNQAKVINT IVNNMIRNRL DTFINMVVVG       840
     AGDEEESNIK RGLWMRAMYG TNNHGRVNNM TGYRGINKGA TVGFDAKINN NIIGIAYSNV       900
     HSVFKFKNSK NNDKELIGSK VISIYGQKEL QQNFTLQVLV SASKNFIKDK INYSYGDTKI       960
     RSNVKHHNHS YNAEALLNYN YLVKNSIIVT PNIGLRYGKS RDGIYNETGI NVQKIALTMK      1020
     ENNILSGILG TKVQVSLRDV LKFNNLGLTF QAAVEHNFEE KTQRINRVVK IFDNIFKQDY      1080
     LIPKQPKTSY NLGTGIIFGI NNTNISVDYN YYLNKHYRSH QGSVKIKVNL                 1130
//

If you have problems or comments...

PBIL Back to PBIL home page