(data stored in SCRATCH3701 zone)

EMBL: AE017197.SCA3

AE017197.SCA3        Location/Qualifiers
FT   CDS             556234..563229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sca3"
FT                   /locus_tag="RT0438"
FT                   /product="cell surface antigen Sca3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03915"
FT                   /db_xref="GOA:Q68WS7"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WS7"
FT                   /protein_id="AAU03915.1"
FT                   /translation="MKKSKILRKFLATASLCGTLFTNSNATGAIIPNSGSVSLNTGAGL
FT                   VGGVFQNGDIIQIVNGGREIKISADKANAVIGGISALRELPDFGGVEVSQNVSIGPLSA
FT                   GENLNTNFGPLKFISNNVTSIITGVDTQTFSNIDFAGKNATLQINKDLNITTKIDNTVA
FT                   GNNGTITFEGSGVISNHIGFTNSLLGINVGNGEAKIDASRANNITINAKNINLTHNNSI
FT                   FTLCDCNITTLKGNINNTTGIDGQGILNLAYDPDSSNIITGDICNIGSLDTINVLRGSA
FT                   TLNSTIVKATNINLQHDTATLNLGDNIIVIGNIKGINNEEERLNLKVNDQIDNEMIIPI
FT                   NKGMSGKLNLQGNATLNGNIDNLRILKFSGGHDKILNLQGNTEVEHIIFEDSILNSGTI
FT                   TVNGLLNTHVVTFNKSNANGGTLIINAKNTISASLLNAIKAKIQINANLTINHPSAGHI
FT                   GDIRIADNTTYTINADIGHVNLLQNGAKIMFEGADAMLALINTSFTDRTFTIYNNLNQS
FT                   GNDEYGIVKIEAITKGITISNHSEPYTIGQDNTHRLKELIVEGGGNIIVDNTVFTKLLS
FT                   INSTGQITFNRTLDLGAGGNIAFGKNGTLVVHGVAGSITTSENNQGILTINSGNVTGTI
FT                   GANGLGLKLVNIGAGSVTCSANVFAPVALTNPSSILILADGVTLTGTVTTHNNTKGILS
FT                   LGIGSNVTGLIGENNATLEKINIGAGASNIDNNIYAGSMVLTDKTSELILNTNVVVNGN
FT                   ITTIAGNNSGKLVFTGNGDITGNIGANGAALQEVVFNGTTNIGGTANSQNFTVAHSEAN
FT                   VVITGLTTGSLKYKDTGTIIANGGLVGDIDFNNKAGKFILGDGTTIDGSVLCTGGIAGT
FT                   LHFIGDGNVTQNIGSDTENSISTINIQGDNTKNVTITNDIFVNNIYFTNGGVLQLGGNL
FT                   TTHNIDFGANGGTLEFNGNNTYNLNAIIVNGQNGILNAFTNLKATDDTIGTVKIINIGQ
FT                   IGTPQNFTIQVNNKNLTLVSNINSSINFCDSNSQLILSAPVDQTIKFINNLNGTGGGII
FT                   TLDGNGNNLTISGNNGIKLGSRDNELSSLNIKGKVTVTHNLDVQNIHQLNINNGAFFND
FT                   HSLTSAKIKNINIGEETGEATYTLDAINCDFDLNTSGMVFKHQDSVLELKNSSNTNDRI
FT                   ITLTSVLDPGNGQSGIIKLITDTNKLTIDNNGNVAYTLGTANHMLKQLTFTSINNGAIA
FT                   LKVGINVENITLNIKDIELNEVNANVLFNKNVTYTATGNINGHVDFQGNAGVINLDDGI
FT                   KIDGSVTSTNDVNGTLNLNGSGEVTGLITNIAMLQAGAGDVSLSASGNYSITEIQGNGN
FT                   NNLTFAANSHLTTDINKTDGQAVNLVFINGGSVSGSVGLSKAVGDIIIHAGNVTFNNTV
FT                   KSSNVVISDGSTMQVNNNITANDISGKNINNGTLKLNNHTPIIITSTLGHNNSIGTIEV
FT                   ANNDVTITGALKAQNIHFSNAAQETTLTLGAASQVTNITTAGNNIHTLEITDLDTGNDG
FT                   TIGTENNRLKSIELTGNGTITINSKHVYSSITTANNEQGNVKLNIEGGIAYDLGSEIRS
FT                   LANVQISEDSTVKGDVYSKYLNIDAGKTINFDRGDNNMNPKNLDIPDAIIDLDVLPRSL
FT                   SLFNYFTDIKADNLNFVDGTATANFKDAVVIDARIDNGGTLKFNNNVWLTQEIKNANSI
FT                   EIASNKFMLLQKNIKAATLIADKANLVLLDNVEINTNLNVRDIVLDLANYELKYTGNVT
FT                   HNGLLTIITYFDTALQKGGHILVGQGSNVDMSDLDNLIIKIKSRSDITNITSDTKHQVV
FT                   KLEAGAIYNPVPQTKVIIDASGEQNKFVKWVTDANGFVLLTNTDTIGQNNTDNGSLDNG
FT                   YVGNSSNNNSSNGVVGPSKDKDHGITDIAPIFDPSPILDYTKNNYVASSIANQLINHVK
FT                   GFGNTTDAGKLLNDLGFMLPNRVTETLDRLSHRTNINGLNEGVAGLNGIEIENFLTDIA
FT                   INMDNFTAEGIGNRLEELIDAGTVNGLNRTNASLNNNNLNLRRLAANNQTVIAAGDEDN
FT                   TVTGIWGMSFYSKIKQNSKNSASGYQSNTGGGIIGFDYNIDNSIVIGAAYTMADSKVKH
FT                   KNDKSGDKTKAKSNIYSIYGLYHWLNNNFFVEAIGVYGRNKIKNYEKRITAITDQTAIG
FT                   KFINTFYSYELLGGYNYLVSNRTTITPMFGIRYTTLKNNSYKENNTTFQNLSIKKNYHD
FT                   KFETILGLNGATHYLAQDIIIKPELHWFINYQYKNKLPNIDARLDGIDEPLTTIRFKSA
FT                   KITYNLGGGISTKNNMIEFGIRYNLSLAKKYTAHQGSLKIKVKL"
     MKKSKILRKF LATASLCGTL FTNSNATGAI IPNSGSVSLN TGAGLVGGVF QNGDIIQIVN        60
     GGREIKISAD KANAVIGGIS ALRELPDFGG VEVSQNVSIG PLSAGENLNT NFGPLKFISN       120
     NVTSIITGVD TQTFSNIDFA GKNATLQINK DLNITTKIDN TVAGNNGTIT FEGSGVISNH       180
     IGFTNSLLGI NVGNGEAKID ASRANNITIN AKNINLTHNN SIFTLCDCNI TTLKGNINNT       240
     TGIDGQGILN LAYDPDSSNI ITGDICNIGS LDTINVLRGS ATLNSTIVKA TNINLQHDTA       300
     TLNLGDNIIV IGNIKGINNE EERLNLKVND QIDNEMIIPI NKGMSGKLNL QGNATLNGNI       360
     DNLRILKFSG GHDKILNLQG NTEVEHIIFE DSILNSGTIT VNGLLNTHVV TFNKSNANGG       420
     TLIINAKNTI SASLLNAIKA KIQINANLTI NHPSAGHIGD IRIADNTTYT INADIGHVNL       480
     LQNGAKIMFE GADAMLALIN TSFTDRTFTI YNNLNQSGND EYGIVKIEAI TKGITISNHS       540
     EPYTIGQDNT HRLKELIVEG GGNIIVDNTV FTKLLSINST GQITFNRTLD LGAGGNIAFG       600
     KNGTLVVHGV AGSITTSENN QGILTINSGN VTGTIGANGL GLKLVNIGAG SVTCSANVFA       660
     PVALTNPSSI LILADGVTLT GTVTTHNNTK GILSLGIGSN VTGLIGENNA TLEKINIGAG       720
     ASNIDNNIYA GSMVLTDKTS ELILNTNVVV NGNITTIAGN NSGKLVFTGN GDITGNIGAN       780
     GAALQEVVFN GTTNIGGTAN SQNFTVAHSE ANVVITGLTT GSLKYKDTGT IIANGGLVGD       840
     IDFNNKAGKF ILGDGTTIDG SVLCTGGIAG TLHFIGDGNV TQNIGSDTEN SISTINIQGD       900
     NTKNVTITND IFVNNIYFTN GGVLQLGGNL TTHNIDFGAN GGTLEFNGNN TYNLNAIIVN       960
     GQNGILNAFT NLKATDDTIG TVKIINIGQI GTPQNFTIQV NNKNLTLVSN INSSINFCDS      1020
     NSQLILSAPV DQTIKFINNL NGTGGGIITL DGNGNNLTIS GNNGIKLGSR DNELSSLNIK      1080
     GKVTVTHNLD VQNIHQLNIN NGAFFNDHSL TSAKIKNINI GEETGEATYT LDAINCDFDL      1140
     NTSGMVFKHQ DSVLELKNSS NTNDRIITLT SVLDPGNGQS GIIKLITDTN KLTIDNNGNV      1200
     AYTLGTANHM LKQLTFTSIN NGAIALKVGI NVENITLNIK DIELNEVNAN VLFNKNVTYT      1260
     ATGNINGHVD FQGNAGVINL DDGIKIDGSV TSTNDVNGTL NLNGSGEVTG LITNIAMLQA      1320
     GAGDVSLSAS GNYSITEIQG NGNNNLTFAA NSHLTTDINK TDGQAVNLVF INGGSVSGSV      1380
     GLSKAVGDII IHAGNVTFNN TVKSSNVVIS DGSTMQVNNN ITANDISGKN INNGTLKLNN      1440
     HTPIIITSTL GHNNSIGTIE VANNDVTITG ALKAQNIHFS NAAQETTLTL GAASQVTNIT      1500
     TAGNNIHTLE ITDLDTGNDG TIGTENNRLK SIELTGNGTI TINSKHVYSS ITTANNEQGN      1560
     VKLNIEGGIA YDLGSEIRSL ANVQISEDST VKGDVYSKYL NIDAGKTINF DRGDNNMNPK      1620
     NLDIPDAIID LDVLPRSLSL FNYFTDIKAD NLNFVDGTAT ANFKDAVVID ARIDNGGTLK      1680
     FNNNVWLTQE IKNANSIEIA SNKFMLLQKN IKAATLIADK ANLVLLDNVE INTNLNVRDI      1740
     VLDLANYELK YTGNVTHNGL LTIITYFDTA LQKGGHILVG QGSNVDMSDL DNLIIKIKSR      1800
     SDITNITSDT KHQVVKLEAG AIYNPVPQTK VIIDASGEQN KFVKWVTDAN GFVLLTNTDT      1860
     IGQNNTDNGS LDNGYVGNSS NNNSSNGVVG PSKDKDHGIT DIAPIFDPSP ILDYTKNNYV      1920
     ASSIANQLIN HVKGFGNTTD AGKLLNDLGF MLPNRVTETL DRLSHRTNIN GLNEGVAGLN      1980
     GIEIENFLTD IAINMDNFTA EGIGNRLEEL IDAGTVNGLN RTNASLNNNN LNLRRLAANN      2040
     QTVIAAGDED NTVTGIWGMS FYSKIKQNSK NSASGYQSNT GGGIIGFDYN IDNSIVIGAA      2100
     YTMADSKVKH KNDKSGDKTK AKSNIYSIYG LYHWLNNNFF VEAIGVYGRN KIKNYEKRIT      2160
     AITDQTAIGK FINTFYSYEL LGGYNYLVSN RTTITPMFGI RYTTLKNNSY KENNTTFQNL      2220
     SIKKNYHDKF ETILGLNGAT HYLAQDIIIK PELHWFINYQ YKNKLPNIDA RLDGIDEPLT      2280
     TIRFKSAKIT YNLGGGISTK NNMIEFGIRY NLSLAKKYTA HQGSLKIKVK L               2331
//

If you have problems or comments...

PBIL Back to PBIL home page