(data stored in SCRATCH3701 zone)

EMBL: AE017197.SECA

AE017197.SECA        Location/Qualifiers
FT   CDS             complement(729876..732593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="RT0564"
FT                   /product="preprotein translocase SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RT0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04031"
FT                   /db_xref="GOA:Q6TUJ8"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6TUJ8"
FT                   /protein_id="AAU04031.1"
FT                   /translation="MFSILKKLFGTANDRTVKKLFSEITKINSLEPAIKILSDAALKNK
FT                   TVEFKEKLKNGATLDDILYEAFAVVREAASRVCGMRHFDVQLIGGLILHRGMIAEMRTG
FT                   EGKTLVATLPAYLNALTGKGVHVVTVNDYLAIRDSASMGKIYNFLGLSVGCIVAGMTDE
FT                   AKRIAYNSDITHATNNELGFDYLRDNMKYSMQERVLRPFNFAIIDEVDSILIDEARTPI
FT                   VISGPVNDNSALYGKIDKIIRLLNDSDFEKDEKLKTINLTEVGITNIESLLIKDGIIKP
FT                   DTGLYDFENLNLVHYVNQALRAHHMFTVDVDYLVREGKVMIIDEFTGRVMEGRRYSEGL
FT                   HQALEAKENVKIQNENQTLASITFQNYFRNYHKLSGMTGTSMTEASELKDIYNLDVVAV
FT                   PTHNKVTRIDLDDEIYGSKQEKYDAILKLIRDCYNRGQPILVGTISIEKSEELSSILNK
FT                   EKIPHNVLNAKFHEQEAFIIAQAGRFKAVTIATNMAGRGTDIMLGGNPEMLIEQLNKDR
FT                   NYVAKTAEIKAQIAEEKQKVIETGGLFVIGTERHESRRIDNQLRGRSGRQGDPGKTQFF
FT                   LSLDDDLMRIFASDRISGVLRTLGLKNGEAIHHPMISRSLEKAQQKVEAHNYEMRKNLL
FT                   RFDDVMNDQRKIIYEQRTEIIKSKDSYGFLNSTTEELARKIVLTFMPLGSYREDWDIDN
FT                   LTVELHRIFSIKFDHNLVHKNDVTEEDITKLVIQMAHDIYKSKEEAYSSELMNNAVKYI
FT                   LLTTLDQVWKDHLYSLDHLRQGISLRAYAQKDPLSEYKREAFNLFEQMLNNLKELFIQT
FT                   VYHFHIDLRHLQKEDISLEHKKLQKNMCESREDPAFSKYNAGNSIETYLKPVVLRVDPK
FT                   DRKPDDPMSWGRVSRNELCPCGSGKKYKYCHGAN"
     MFSILKKLFG TANDRTVKKL FSEITKINSL EPAIKILSDA ALKNKTVEFK EKLKNGATLD        60
     DILYEAFAVV REAASRVCGM RHFDVQLIGG LILHRGMIAE MRTGEGKTLV ATLPAYLNAL       120
     TGKGVHVVTV NDYLAIRDSA SMGKIYNFLG LSVGCIVAGM TDEAKRIAYN SDITHATNNE       180
     LGFDYLRDNM KYSMQERVLR PFNFAIIDEV DSILIDEART PIVISGPVND NSALYGKIDK       240
     IIRLLNDSDF EKDEKLKTIN LTEVGITNIE SLLIKDGIIK PDTGLYDFEN LNLVHYVNQA       300
     LRAHHMFTVD VDYLVREGKV MIIDEFTGRV MEGRRYSEGL HQALEAKENV KIQNENQTLA       360
     SITFQNYFRN YHKLSGMTGT SMTEASELKD IYNLDVVAVP THNKVTRIDL DDEIYGSKQE       420
     KYDAILKLIR DCYNRGQPIL VGTISIEKSE ELSSILNKEK IPHNVLNAKF HEQEAFIIAQ       480
     AGRFKAVTIA TNMAGRGTDI MLGGNPEMLI EQLNKDRNYV AKTAEIKAQI AEEKQKVIET       540
     GGLFVIGTER HESRRIDNQL RGRSGRQGDP GKTQFFLSLD DDLMRIFASD RISGVLRTLG       600
     LKNGEAIHHP MISRSLEKAQ QKVEAHNYEM RKNLLRFDDV MNDQRKIIYE QRTEIIKSKD       660
     SYGFLNSTTE ELARKIVLTF MPLGSYREDW DIDNLTVELH RIFSIKFDHN LVHKNDVTEE       720
     DITKLVIQMA HDIYKSKEEA YSSELMNNAV KYILLTTLDQ VWKDHLYSLD HLRQGISLRA       780
     YAQKDPLSEY KREAFNLFEQ MLNNLKELFI QTVYHFHIDL RHLQKEDISL EHKKLQKNMC       840
     ESREDPAFSK YNAGNSIETY LKPVVLRVDP KDRKPDDPMS WGRVSRNELC PCGSGKKYKY       900
     CHGAN                                                                   905
//

If you have problems or comments...

PBIL Back to PBIL home page