(data stored in SCRATCH3701 zone)

EMBL: AE017197.SECD

AE017197.SECD        Location/Qualifiers
FT   CDS             744157..745713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="RT0575"
FT                   /product="protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:RT0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04040"
FT                   /db_xref="GOA:Q68WF2"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WF2"
FT                   /protein_id="AAU04040.1"
FT                   /translation="MQNLPKWKIVLSIICTVFAIICALPNFIQINWKFLPHDSVNLGLD
FT                   LRGGANLLLDVDFDTYLNDSMENIADTLRKNFREHKIGYKNLLVRHNNIQLEVRSTEVL
FT                   KSLKKIIHKIDPEIIIEVNKNKIKLRYSESRLNDLLNKVVEQSIEIVRMRIDSTGTKEP
FT                   ILQRQGNKHILLQVPGVDNPSYLKNILGKTAKLTFHLVDENANIEEAIKGHIPLDSMLI
FT                   KGDSEHHGEYYIVIKKKVLLSGTHLTKASASFDQNSQPMVAFSFNNLGSKIFTEITKNN
FT                   TGKRLAIVLDNKLLSAPMINGAIIGGDGIITGNFTIESANELALLLRVGSLPTPLKIIE
FT                   ERSIGPNLGADSIESGKKAGLIGFTAVCIFMILSYGVIGLFANIALILALLYILALLSL
FT                   FQATLTLPGIAGIILTMGMAVDANVLIYERIKEELHKGVSNLYAIRTGFESAFATIIDS
FT                   NLTTLIVAFALYIFGVGAIKGFAVALTIGIISSMFSAIIITKLLIDIWVKYFKPEKLGL
FT                   L"
     MQNLPKWKIV LSIICTVFAI ICALPNFIQI NWKFLPHDSV NLGLDLRGGA NLLLDVDFDT        60
     YLNDSMENIA DTLRKNFREH KIGYKNLLVR HNNIQLEVRS TEVLKSLKKI IHKIDPEIII       120
     EVNKNKIKLR YSESRLNDLL NKVVEQSIEI VRMRIDSTGT KEPILQRQGN KHILLQVPGV       180
     DNPSYLKNIL GKTAKLTFHL VDENANIEEA IKGHIPLDSM LIKGDSEHHG EYYIVIKKKV       240
     LLSGTHLTKA SASFDQNSQP MVAFSFNNLG SKIFTEITKN NTGKRLAIVL DNKLLSAPMI       300
     NGAIIGGDGI ITGNFTIESA NELALLLRVG SLPTPLKIIE ERSIGPNLGA DSIESGKKAG       360
     LIGFTAVCIF MILSYGVIGL FANIALILAL LYILALLSLF QATLTLPGIA GIILTMGMAV       420
     DANVLIYERI KEELHKGVSN LYAIRTGFES AFATIIDSNL TTLIVAFALY IFGVGAIKGF       480
     AVALTIGIIS SMFSAIIITK LLIDIWVKYF KPEKLGLL                               518
//

If you have problems or comments...

PBIL Back to PBIL home page