(data stored in SCRATCH3701 zone)

EMBL: AE017197.SECE

AE017197.SECE        Location/Qualifiers
FT   CDS             157133..157333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="RT0123"
FT                   /product="preprotein translocase SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RT0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03608"
FT                   /db_xref="GOA:Q68XN4"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XN4"
FT                   /protein_id="AAU03608.1"
FT                   /translation="MFREYKMYKFFEQVKQETYKVFWPNRKELIASTLVVVAAVFIFSL
FT                   ICLVLDYSIHNIMQLLLTIGK"
     MFREYKMYKF FEQVKQETYK VFWPNRKELI ASTLVVVAAV FIFSLICLVL DYSIHNIMQL        60
     LLTIGK                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page