(data stored in SCRATCH3701 zone)

EMBL: AE017197.SECG

AE017197.SECG        Location/Qualifiers
FT   CDS             complement(73210..73512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="RT0053"
FT                   /product="protein-export membrane protein SecG"
FT                   /db_xref="EnsemblGenomes-Gn:RT0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03540"
FT                   /db_xref="GOA:Q68XV2"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XV2"
FT                   /protein_id="AAU03540.1"
FT                   /translation="MLDILLFVHITISILLIIVILMQRSGSGGISGISGDNNMGVVSAK
FT                   TVGNFLSKSTIILTTLFLINAIILANLSSKKKSNLVSKINEIEENQTDNSLPIAK"
     MLDILLFVHI TISILLIIVI LMQRSGSGGI SGISGDNNMG VVSAKTVGNF LSKSTIILTT        60
     LFLINAIILA NLSSKKKSNL VSKINEIEEN QTDNSLPIAK                             100
//

If you have problems or comments...

PBIL Back to PBIL home page