(data stored in SCRATCH3701 zone)

EMBL: AE017197.SECY

AE017197.SECY        Location/Qualifiers
FT   CDS             complement(817913..819214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="RT0631"
FT                   /product="preprotein translocase SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RT0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04094"
FT                   /db_xref="GOA:Q68W98"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W98"
FT                   /protein_id="AAU04094.1"
FT                   /translation="MGQNFSKKSSNDLVSRIIFTIFMLIICRIGSFIPIPGIDSIALNS
FT                   VAEKNQFGILGMFNMLSGGSLGRMSIFALAIMPYITASIIIQLMSVAYKPLENLKKEGE
FT                   SGKRKINQLSRYLTVLLASFQAYGVALSLESMVTNTGPVVILAGFFFRVTTVITLVVGT
FT                   MLLMWLGEQITQRGIGNGTSLIIFIGIISGVPSAIISMFELSRKGALSPLIAITVCIGV
FT                   VLLIAIIIFFEKAQRKLLVQYPKRQVGNKIYGGEATHMPLKLNTSGVIPPIFASSILLF
FT                   PTTLANFSNSNSETMSMLSYYLGHGKPVYILLYVVLIMFFSFFYTAIVFNSEETANNLR
FT                   KYGAYIPGKRPGKNTSDYFDYILTRLTVIGGLYLSIICVIPELLMNKYVISLSLGGTSF
FT                   LIVVNVVLDTMTQIQTYLFSSKYEGLMKKIKLKN"
     MGQNFSKKSS NDLVSRIIFT IFMLIICRIG SFIPIPGIDS IALNSVAEKN QFGILGMFNM        60
     LSGGSLGRMS IFALAIMPYI TASIIIQLMS VAYKPLENLK KEGESGKRKI NQLSRYLTVL       120
     LASFQAYGVA LSLESMVTNT GPVVILAGFF FRVTTVITLV VGTMLLMWLG EQITQRGIGN       180
     GTSLIIFIGI ISGVPSAIIS MFELSRKGAL SPLIAITVCI GVVLLIAIII FFEKAQRKLL       240
     VQYPKRQVGN KIYGGEATHM PLKLNTSGVI PPIFASSILL FPTTLANFSN SNSETMSMLS       300
     YYLGHGKPVY ILLYVVLIMF FSFFYTAIVF NSEETANNLR KYGAYIPGKR PGKNTSDYFD       360
     YILTRLTVIG GLYLSIICVI PELLMNKYVI SLSLGGTSFL IVVNVVLDTM TQIQTYLFSS       420
     KYEGLMKKIK LKN                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page