(data stored in SCRATCH3701 zone)

EMBL: AE017197.TLCC

AE017197.TLCC        Location/Qualifiers
FT   CDS             594760..596265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlcC"
FT                   /locus_tag="RT0464"
FT                   /product="ADP/ATP carrier protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03939"
FT                   /db_xref="GOA:Q68WQ3"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WQ3"
FT                   /protein_id="AAU03939.1"
FT                   /translation="MLPPKIFFEKFKEIIWPIERKELKLFIPMALMMLCILFNFGALRS
FT                   IKDSLVVPSMGAEIISFLKLWLVLPSCVIFTVLYVKLSNKLNFEYIFYSIVGTFLLFFL
FT                   LFAYIIYPNQDIYHPNDAMINNLIASYPNLKWFIKIGSKWSYALMYIFSELWSAVVINL
FT                   MFWQFANHIFDTAKAKRFYPVLGMIGNIGLIIAGSVLVFFSSGQYIIDSELLTDSFNSS
FT                   SCNSIILQPIISIIVTAGIIAMFLFRIINRFILTNAINVLDVKKAAARTKTKLALIESI
FT                   KLIIHSKYIGRIALLIICYGLLINIVEGPWKAKIKELHPNTIDYVNFMGMFNIWMGISC
FT                   VTFMIIGSNILRRLGWLISALLTPIMLSITGFIFFIFIIFIEEIGTCFGDFNLLYVAII
FT                   VGAIQNILSKSSKYSLFDSTKEMAYIPLSLELRTKGKAAVEVIGTKFGKSLGAFIQSLI
FT                   FIIIPTATFDSIIIYLLVIFIVMMNLWIWNIIKLNKEYIKLCK"
     MLPPKIFFEK FKEIIWPIER KELKLFIPMA LMMLCILFNF GALRSIKDSL VVPSMGAEII        60
     SFLKLWLVLP SCVIFTVLYV KLSNKLNFEY IFYSIVGTFL LFFLLFAYII YPNQDIYHPN       120
     DAMINNLIAS YPNLKWFIKI GSKWSYALMY IFSELWSAVV INLMFWQFAN HIFDTAKAKR       180
     FYPVLGMIGN IGLIIAGSVL VFFSSGQYII DSELLTDSFN SSSCNSIILQ PIISIIVTAG       240
     IIAMFLFRII NRFILTNAIN VLDVKKAAAR TKTKLALIES IKLIIHSKYI GRIALLIICY       300
     GLLINIVEGP WKAKIKELHP NTIDYVNFMG MFNIWMGISC VTFMIIGSNI LRRLGWLISA       360
     LLTPIMLSIT GFIFFIFIIF IEEIGTCFGD FNLLYVAIIV GAIQNILSKS SKYSLFDSTK       420
     EMAYIPLSLE LRTKGKAAVE VIGTKFGKSL GAFIQSLIFI IIPTATFDSI IIYLLVIFIV       480
     MMNLWIWNII KLNKEYIKLC K                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page