(data stored in SCRATCH3701 zone)

EMBL: AE017197.TLCD

AE017197.TLCD        Location/Qualifiers
FT   CDS             complement(621462..623000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlcD"
FT                   /locus_tag="RT0486"
FT                   /product="ADP/ATP carrier protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:RT0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03958"
FT                   /db_xref="GOA:Q83W27"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83W27"
FT                   /protein_id="AAU03958.1"
FT                   /translation="MTINASNIENSFSKINSHFSKLTDYIWPIKRNEISKFLFITLLMF
FT                   CILFIQNLIRALKDSIVTTMIGAETISFLKFWGVMPSAFLITVMYVKLVNRMKAENIFY
FT                   LIISIFLIFFALFAYVIFPNHEILHLRPVTVHNLTTSLPNLKWFILLLSKWSFSLFYII
FT                   AELWPNVVFALLFWQFVNNITTVEESKRFYPLFGLLSQTGIYLAGHFLENLSKINYYIT
FT                   DKFALQSSFHTLSIQIILTIVLILGIVSIKTFWLLNHKVLDKKHMSLLRFKTKNKSITI
FT                   AKSFQMILSSRHIRLIATLLICYGIAINLVEGPWKAAATKIYKTPTEYAAFIGSYLSYT
FT                   GVFTIFFVLLGSNIVRRIGWFTSAVITPSIVFITGILFFAFNNFEGFAGLIIANFILTD
FT                   PALVAITIGAIQNVLSKSSKYTLFDSTKEMAYVPLEPEIKISGKAAADVIGTKLGKSGS
FT                   AFLQSLIFIILPSSSYQSISICLMIIFILTCLTWIWATKELNKEYKNSIKFSQK"
     MTINASNIEN SFSKINSHFS KLTDYIWPIK RNEISKFLFI TLLMFCILFI QNLIRALKDS        60
     IVTTMIGAET ISFLKFWGVM PSAFLITVMY VKLVNRMKAE NIFYLIISIF LIFFALFAYV       120
     IFPNHEILHL RPVTVHNLTT SLPNLKWFIL LLSKWSFSLF YIIAELWPNV VFALLFWQFV       180
     NNITTVEESK RFYPLFGLLS QTGIYLAGHF LENLSKINYY ITDKFALQSS FHTLSIQIIL       240
     TIVLILGIVS IKTFWLLNHK VLDKKHMSLL RFKTKNKSIT IAKSFQMILS SRHIRLIATL       300
     LICYGIAINL VEGPWKAAAT KIYKTPTEYA AFIGSYLSYT GVFTIFFVLL GSNIVRRIGW       360
     FTSAVITPSI VFITGILFFA FNNFEGFAGL IIANFILTDP ALVAITIGAI QNVLSKSSKY       420
     TLFDSTKEMA YVPLEPEIKI SGKAAADVIG TKLGKSGSAF LQSLIFIILP SSSYQSISIC       480
     LMIIFILTCL TWIWATKELN KEYKNSIKFS QK                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page