(data stored in SCRATCH3701 zone)

EMBL: AE017197.TOLB

AE017197.TOLB        Location/Qualifiers
FT   CDS             371082..372413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="RT0293"
FT                   /product="TolB protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03773"
FT                   /db_xref="GOA:Q68X69"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X69"
FT                   /protein_id="AAU03773.1"
FT                   /translation="MRNIVYFILTLFSLTGYALETINIEHGRVDPTPIAVNKFNADSSN
FT                   NDLVGNAVVKVISNDLKISGLFRPISSASFIEEQTGINYKPLFAAWRQINASLLVNGEV
FT                   QTLESGKLKISFILWDTFLEKQLIGALFEVPTKLWRRAAHKIADKIYEKITGDPGYFDT
FT                   KIVYVSESTALPKIKRIALMDYDGANNKYLTNGKSLVLTPRFAHSADKIFYVSYATKSR
FT                   ALVYEKDLKTGKESVVGDFVGISFAPRFSPDGKKAVMSIAKNGSTHIYEIDLATKQLNK
FT                   LTDGFGINTSPSYSPDGKKIVYNSDKNGVPQLYIMNSDGSDVRRISFGGGSYASPSWSP
FT                   RGDYIAFTKITRHDGEKIFNIGIMKAYPQDHENSERIITSGYLVESPCWSPNGRVIMFS
FT                   KGWPSRAKAPGKNKIFTIDLTGHNEREVITPAGASDPEWSDVLN"
     MRNIVYFILT LFSLTGYALE TINIEHGRVD PTPIAVNKFN ADSSNNDLVG NAVVKVISND        60
     LKISGLFRPI SSASFIEEQT GINYKPLFAA WRQINASLLV NGEVQTLESG KLKISFILWD       120
     TFLEKQLIGA LFEVPTKLWR RAAHKIADKI YEKITGDPGY FDTKIVYVSE STALPKIKRI       180
     ALMDYDGANN KYLTNGKSLV LTPRFAHSAD KIFYVSYATK SRALVYEKDL KTGKESVVGD       240
     FVGISFAPRF SPDGKKAVMS IAKNGSTHIY EIDLATKQLN KLTDGFGINT SPSYSPDGKK       300
     IVYNSDKNGV PQLYIMNSDG SDVRRISFGG GSYASPSWSP RGDYIAFTKI TRHDGEKIFN       360
     IGIMKAYPQD HENSERIITS GYLVESPCWS PNGRVIMFSK GWPSRAKAPG KNKIFTIDLT       420
     GHNEREVITP AGASDPEWSD VLN                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page