(data stored in SCRATCH3701 zone)

EMBL: AE017197.UVRB

AE017197.UVRB        Location/Qualifiers
FT   CDS             complement(244545..246533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="RT0193"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:RT0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03677"
FT                   /db_xref="GOA:Q68XG5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XG5"
FT                   /protein_id="AAU03677.1"
FT                   /translation="MNNFSIISAYKPAGGQPKAIDEIIAGLNSKKRSQMLLGITGSGKT
FT                   FTMANIIERTNRPTLIMAHNKTLAAQIYLEMKSIFPKNAVEYFVSYYDYYQPEAYIVRT
FT                   DTFIEKDSSINEQIDLMRHSATRSLLERRDVIVIASVSCIYGLGAPDLYYQMTVHLELG
FT                   QSYPRDKLLNDLINLQYKRNDIGFERGCFRVKGDHIDIFPSHYSDKAWRLSFFGNELEY
FT                   IHEFDPLTGEKLTQLDKAMVFGNSHFVMPQKTINNAISSIEVELQKHLDVLKSQDKLIE
FT                   AKRLNQRTQYDLEMLTETGSCKGIENYSRFFTGRNAGEPPPTLFEYLPKDALLFLDESH
FT                   VSIPQIRAMYNSDRARKEVLVEHGFRLPSALDNRPLKFEEWEKFRPQTVFVSATPGPFE
FT                   LEETGGTVVELIIRPTGLLDPECIIKPATNQVEDLISEIQTTITKGLRILVTTLTKKMA
FT                   EDLTSYLQDLQYKTYYLHSNIHTLERIEILRDLRQGNIDILVGINLLREGIDIPECGLV
FT                   AILDADKEGFLRSEVSLIQTIGRAARNSRGKVILYADKMTKSIDKAVSETLRRRQIQQE
FT                   YNKKYGIIPKTINSAIHTLESLEEIHDNKLDKKQTNTLLNNPAKLKSYMDKLKKEMFKA
FT                   ASNLEFEQAAKLRNQLKTLEKAVLELS"
     MNNFSIISAY KPAGGQPKAI DEIIAGLNSK KRSQMLLGIT GSGKTFTMAN IIERTNRPTL        60
     IMAHNKTLAA QIYLEMKSIF PKNAVEYFVS YYDYYQPEAY IVRTDTFIEK DSSINEQIDL       120
     MRHSATRSLL ERRDVIVIAS VSCIYGLGAP DLYYQMTVHL ELGQSYPRDK LLNDLINLQY       180
     KRNDIGFERG CFRVKGDHID IFPSHYSDKA WRLSFFGNEL EYIHEFDPLT GEKLTQLDKA       240
     MVFGNSHFVM PQKTINNAIS SIEVELQKHL DVLKSQDKLI EAKRLNQRTQ YDLEMLTETG       300
     SCKGIENYSR FFTGRNAGEP PPTLFEYLPK DALLFLDESH VSIPQIRAMY NSDRARKEVL       360
     VEHGFRLPSA LDNRPLKFEE WEKFRPQTVF VSATPGPFEL EETGGTVVEL IIRPTGLLDP       420
     ECIIKPATNQ VEDLISEIQT TITKGLRILV TTLTKKMAED LTSYLQDLQY KTYYLHSNIH       480
     TLERIEILRD LRQGNIDILV GINLLREGID IPECGLVAIL DADKEGFLRS EVSLIQTIGR       540
     AARNSRGKVI LYADKMTKSI DKAVSETLRR RQIQQEYNKK YGIIPKTINS AIHTLESLEE       600
     IHDNKLDKKQ TNTLLNNPAK LKSYMDKLKK EMFKAASNLE FEQAAKLRNQ LKTLEKAVLE       660
     LS                                                                      662
//

If you have problems or comments...

PBIL Back to PBIL home page