(data stored in SCRATCH3701 zone)

EMBL: AE017197.UVRC

AE017197.UVRC        Location/Qualifiers
FT   CDS             complement(724994..726874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="RT0560"
FT                   /product="excinuclease ABC subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:RT0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04028"
FT                   /db_xref="GOA:Q68WG4"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WG4"
FT                   /protein_id="AAU04028.1"
FT                   /translation="MSLEISGRELIKSKIIDAPECSGVYKMLDVSKQVIYVGKAKILKK
FT                   RLTNYIKSDLDNKTLRMIANTYFLEYIITHSEVEALLLEAQLIKKFQPKFNILLKDDKS
FT                   FPFIKLSLDHDFPQLLKYRGKALSDGKLFGPFASNTQVNTTLTELQKIFKLRSCTDNYF
FT                   NSRTRPCLQYEIKRCYAPCVGKINKENYRVLVIQVKDFLQCRTRELQENLSKKMQELSS
FT                   QMRFEEAAEIRDRIKALSYVQLKSRILDVVKNADIISIVHKDLHYCIEVALYRAGQPYG
FT                   NIPYFFSSTENSTHEEVLEYFLLQFYQKQQVPSEIIMNHEINSKENVIEAIKKINNISD
FT                   LSIIVPHKGDKAKLVHKAEVNALFSLEQYLKKITKNTEIMFEVKKLFDLPEIPERIEIY
FT                   DNSHIQGMFAVGVMVVAGKIGFDKKEYRVFSLSSRNFTIGSEIELRDDIKGDDYGMLRQ
FT                   VLTRRFTRLKNEPNKLPSLMIIDGGKGHLTVVKEVMDKFGMNIPFVCMSKGRDRNAGLE
FT                   QLHMQGKEVFTLDKNLLVMKYLQILRDEAHNFAIKNHRLGRSRAIKISSLDDIDGVGEA
FT                   RKTALLHYFGSYKAVCNATIDELAKVKGISKSLASMIFNVLNRKISLDNS"
     MSLEISGREL IKSKIIDAPE CSGVYKMLDV SKQVIYVGKA KILKKRLTNY IKSDLDNKTL        60
     RMIANTYFLE YIITHSEVEA LLLEAQLIKK FQPKFNILLK DDKSFPFIKL SLDHDFPQLL       120
     KYRGKALSDG KLFGPFASNT QVNTTLTELQ KIFKLRSCTD NYFNSRTRPC LQYEIKRCYA       180
     PCVGKINKEN YRVLVIQVKD FLQCRTRELQ ENLSKKMQEL SSQMRFEEAA EIRDRIKALS       240
     YVQLKSRILD VVKNADIISI VHKDLHYCIE VALYRAGQPY GNIPYFFSST ENSTHEEVLE       300
     YFLLQFYQKQ QVPSEIIMNH EINSKENVIE AIKKINNISD LSIIVPHKGD KAKLVHKAEV       360
     NALFSLEQYL KKITKNTEIM FEVKKLFDLP EIPERIEIYD NSHIQGMFAV GVMVVAGKIG       420
     FDKKEYRVFS LSSRNFTIGS EIELRDDIKG DDYGMLRQVL TRRFTRLKNE PNKLPSLMII       480
     DGGKGHLTVV KEVMDKFGMN IPFVCMSKGR DRNAGLEQLH MQGKEVFTLD KNLLVMKYLQ       540
     ILRDEAHNFA IKNHRLGRSR AIKISSLDDI DGVGEARKTA LLHYFGSYKA VCNATIDELA       600
     KVKGISKSLA SMIFNVLNRK ISLDNS                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page