(data stored in SCRATCH3701 zone)

EMBL: AE017197.VIRB10

AE017197.VIRB10      Location/Qualifiers
FT   CDS             354946..356397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB10"
FT                   /locus_tag="RT0282"
FT                   /product="VirB10 protein of the type IV secretion system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03762"
FT                   /db_xref="GOA:Q68X80"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X80"
FT                   /protein_id="AAU03762.1"
FT                   /translation="MVAEQNNNNNTDSLSGTDLPEVQRELSKVSVSFNKNIAIVVVICA
FT                   ILIYIFYTLFFDMRKEEIPETKIPSNIVTPVTDVNDIIPEIPKLPDPPKLERPTVLQPP
FT                   PPPPPVVEVPPVLPPISIEGNKEQTLQLPPVSLPTTSSTLVESDAEKQRREAKRKSAIV
FT                   LVGGVEPKKTPEQITEAVTFKDRGDMFLLLGRGKLIDAVLETGINSDLGGEIRAIISRD
FT                   VFSEKGKVILIPKGSKIFGKYATSTSSDSYGRVSIIWDRVDLTNGYTIEFDSPAVDNLG
FT                   RPGLQGRVDNKYKEQFANAVLQSGFNIGLAKILDKLVPPPIDSQAAATNSATATQILNI
FT                   AQTISSNTAIDVNTRIVTICTNILAAITDKTSIAYTTMTQACATAQNASSANTSEQRLQ
FT                   TLVQAVNTAASNLLTTTSIASTPTQAQQASTQAFTDVTNVVQNMITQQHFKPTTTVNQG
FT                   TPIRIYVNKDYKFPRTVLLKSKVMK"
     MVAEQNNNNN TDSLSGTDLP EVQRELSKVS VSFNKNIAIV VVICAILIYI FYTLFFDMRK        60
     EEIPETKIPS NIVTPVTDVN DIIPEIPKLP DPPKLERPTV LQPPPPPPPV VEVPPVLPPI       120
     SIEGNKEQTL QLPPVSLPTT SSTLVESDAE KQRREAKRKS AIVLVGGVEP KKTPEQITEA       180
     VTFKDRGDMF LLLGRGKLID AVLETGINSD LGGEIRAIIS RDVFSEKGKV ILIPKGSKIF       240
     GKYATSTSSD SYGRVSIIWD RVDLTNGYTI EFDSPAVDNL GRPGLQGRVD NKYKEQFANA       300
     VLQSGFNIGL AKILDKLVPP PIDSQAAATN SATATQILNI AQTISSNTAI DVNTRIVTIC       360
     TNILAAITDK TSIAYTTMTQ ACATAQNASS ANTSEQRLQT LVQAVNTAAS NLLTTTSIAS       420
     TPTQAQQAST QAFTDVTNVV QNMITQQHFK PTTTVNQGTP IRIYVNKDYK FPRTVLLKSK       480
     VMK                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page