(data stored in SCRATCH3701 zone)

EMBL: AE017197.VIRB11

AE017197.VIRB11      Location/Qualifiers
FT   CDS             356394..357398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB11"
FT                   /locus_tag="RT0283"
FT                   /product="VirB11 protein of the type IV secretion system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03763"
FT                   /db_xref="GOA:Q68X79"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X79"
FT                   /protein_id="AAU03763.1"
FT                   /translation="MNEEFAALETFLLPFKNLFAEDGINEIMVNKPGEAWVEKRGDIYS
FT                   KQIPELDSEHLLALGRLVAQSTEQMISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYS
FT                   IRKPSGMNLTLDEYAQMGAFDNTATESLVDEDADILNNFLAEKKIKEFIRYAVISKKNI
FT                   IISGGTSTGKTTFTNAALTEIPAVERLITVEDAREVVLSSHPNRVHLLASKGGQGRANV
FT                   TTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLKL
FT                   MVMQADLGMPPEEVKKYILSVVDIVVQLKRASGGKRYVSEVYYKKNKNSESML"
     MNEEFAALET FLLPFKNLFA EDGINEIMVN KPGEAWVEKR GDIYSKQIPE LDSEHLLALG        60
     RLVAQSTEQM ISEEKPLLSA TLPNGYRIQI VFPPACEIGQ IIYSIRKPSG MNLTLDEYAQ       120
     MGAFDNTATE SLVDEDADIL NNFLAEKKIK EFIRYAVISK KNIIISGGTS TGKTTFTNAA       180
     LTEIPAVERL ITVEDAREVV LSSHPNRVHL LASKGGQGRA NVTTQDLIEA CLRLRPDRII       240
     VGELRGKEAF SFLRAINTGH PGSISTLHAD SPAMAIEQLK LMVMQADLGM PPEEVKKYIL       300
     SVVDIVVQLK RASGGKRYVS EVYYKKNKNS ESML                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page