(data stored in SCRATCH3701 zone)

EMBL: AE017197.VIRB3

AE017197.VIRB3       Location/Qualifiers
FT   CDS             complement(47136..47423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB3"
FT                   /locus_tag="RT0034"
FT                   /product="probable type IV secretory system protein VirB3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03522"
FT                   /db_xref="GOA:Q68XX0"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XX0"
FT                   /protein_id="AAU03522.1"
FT                   /translation="MSGTLASDLLFVGLTRPPMIFGVSIKFAALNMIMTMIVFIWNNGI
FT                   MILFIAGALHLVAYIICFKEPRFIELYLNKMSRTSQCPNKFYYGANSYNI"
     MSGTLASDLL FVGLTRPPMI FGVSIKFAAL NMIMTMIVFI WNNGIMILFI AGALHLVAYI        60
     ICFKEPRFIE LYLNKMSRTS QCPNKFYYGA NSYNI                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page