(data stored in ACNUC10821 zone)

EMBL: AE017262.ADA

AE017262.ADA         Location/Qualifiers
FT   CDS             90096..91148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="LMOf2365_0093"
FT                   /product="Ada regulatory protein"
FT                   /EC_number="2.1.1.63"
FT                   /note="identified by similarity to SP:P06134; match to
FT                   protein family HMM PF00165; match to protein family HMM
FT                   PF01035; match to protein family HMM PF02805; match to
FT                   protein family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02881"
FT                   /protein_id="AAT02881.1"
FT                   /translation="MITNQRDIDKYYDMLVEKNSNYEGVFFVGVKTTGILCRPTCPAKK
FT                   PLKENCEFFSTAKEALLASYRPCKRCEPLSNPTKLSPAVKLLVDAIEKNPEKKWTDKDF
FT                   DELSISANTARRQFKKQFGMTFIEYARSRRLGLAFKHIRGGNSIINAQIESGYESGNGF
FT                   RDAFSKTMGEVPHKSNDITILYSAWLETKLGSMLAISDDDSLLLLEFVDRKGLETEIKK
FT                   LRMRLNAAITPEKTVIIQQIEAELARYFNGELIDFKTPICYIGSDFQQSVWNELRRIPI
FT                   GETISYKSLAEKLGRPTASRAVARANGANQLSLIVPCHRVINTNGALGGYGGGLARKEW
FT                   LIKHEKMVPR"
     MITNQRDIDK YYDMLVEKNS NYEGVFFVGV KTTGILCRPT CPAKKPLKEN CEFFSTAKEA        60
     LLASYRPCKR CEPLSNPTKL SPAVKLLVDA IEKNPEKKWT DKDFDELSIS ANTARRQFKK       120
     QFGMTFIEYA RSRRLGLAFK HIRGGNSIIN AQIESGYESG NGFRDAFSKT MGEVPHKSND       180
     ITILYSAWLE TKLGSMLAIS DDDSLLLLEF VDRKGLETEI KKLRMRLNAA ITPEKTVIIQ       240
     QIEAELARYF NGELIDFKTP ICYIGSDFQQ SVWNELRRIP IGETISYKSL AEKLGRPTAS       300
     RAVARANGAN QLSLIVPCHR VINTNGALGG YGGGLARKEW LIKHEKMVPR                  350
//

If you have problems or comments...

PBIL Back to PBIL home page