(data stored in ACNUC10821 zone)

EMBL: AE017262.AGRA

AE017262.AGRA        Location/Qualifiers
FT   CDS             60126..60854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agrA"
FT                   /locus_tag="LMOf2365_0060"
FT                   /product="accessory gene regulator protein A"
FT                   /note="identified by similarity to SP:P13131; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02848"
FT                   /protein_id="AAT02848.1"
FT                   /translation="MLPVFICEDNRMQRERLTKYIEDYIMVEHFDMKLELSTGDPFELV
FT                   SRMPTHQGMGLYFLDIDLGQPDMNGFELAQEIRKFDPRGFIIFITTHAELSYMTFTYKV
FT                   EALDYIIKDDIDLLHDRVLACMKQAEERISNDQDMQKYFTFKVSDKKIIHELLDDILFF
FT                   ETAPTIHKVILHGKNRQVEFYGKLKNIEKMLDESFYRCHRSYIVNKKNIHELDTTKGVV
FT                   KMSNGENCYASSKLIKSLSL"
     MLPVFICEDN RMQRERLTKY IEDYIMVEHF DMKLELSTGD PFELVSRMPT HQGMGLYFLD        60
     IDLGQPDMNG FELAQEIRKF DPRGFIIFIT THAELSYMTF TYKVEALDYI IKDDIDLLHD       120
     RVLACMKQAE ERISNDQDMQ KYFTFKVSDK KIIHELLDDI LFFETAPTIH KVILHGKNRQ       180
     VEFYGKLKNI EKMLDESFYR CHRSYIVNKK NIHELDTTKG VVKMSNGENC YASSKLIKSL       240
     SL                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page