(data stored in ACNUC10821 zone)

EMBL: AE017262.ARCA

AE017262.ARCA        Location/Qualifiers
FT   CDS             54257..55489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="LMOf2365_0052"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="identified by match to protein family HMM PF02274;
FT                   match to protein family HMM TIGR01078"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02840"
FT                   /db_xref="GOA:Q725C1"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725C1"
FT                   /protein_id="AAT02840.1"
FT                   /translation="MKMEQALNITSEIGKLQTVLVKRPGSELENITPEYLESLLFDDIP
FT                   YLKMMQKEHDFFAKTMKDSNIEVLYLEKLAAEALREANNKESFLTKMIKESNQMDESAL
FT                   YVRDYLMSFDEEEMIRKLMSGLKKSEIPERKKKHLNEMMDEQYPFFLDPLPNLYFTRDP
FT                   AAVIGNGVTINRMFQPARRRESMFIELILKHHPRFSNQEIPVWSGRGEPFSLEGGDELV
FT                   LNEETVLVGVSERTDARAVERLAESLFSRSPKIKRVLAVEIPETRSFMHLDTVFTMVNF
FT                   AQFTIHPAIQNQQGELNIYILEKSENGLEITPRRDFQRVIAEVLDEPEIDFIPCGGEDV
FT                   IVSAREQWNDGANTLAIAPGEVITYDRNQVSNDLLRSAGIKVHEVISSELSRGRGGPRC
FT                   MTMPLVRENLK"
     MKMEQALNIT SEIGKLQTVL VKRPGSELEN ITPEYLESLL FDDIPYLKMM QKEHDFFAKT        60
     MKDSNIEVLY LEKLAAEALR EANNKESFLT KMIKESNQMD ESALYVRDYL MSFDEEEMIR       120
     KLMSGLKKSE IPERKKKHLN EMMDEQYPFF LDPLPNLYFT RDPAAVIGNG VTINRMFQPA       180
     RRRESMFIEL ILKHHPRFSN QEIPVWSGRG EPFSLEGGDE LVLNEETVLV GVSERTDARA       240
     VERLAESLFS RSPKIKRVLA VEIPETRSFM HLDTVFTMVN FAQFTIHPAI QNQQGELNIY       300
     ILEKSENGLE ITPRRDFQRV IAEVLDEPEI DFIPCGGEDV IVSAREQWND GANTLAIAPG       360
     EVITYDRNQV SNDLLRSAGI KVHEVISSEL SRGRGGPRCM TMPLVRENLK                  410
//

If you have problems or comments...

PBIL Back to PBIL home page