(data stored in ACNUC10821 zone)

EMBL: AE017262.AROD

AE017262.AROD        Location/Qualifiers
FT   CDS             536571..537329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="LMOf2365_0521"
FT                   /product="3-dehydroquinate dehydratase, type I"
FT                   /EC_number="4.2.1.10"
FT                   /note="identified by similarity to SP:P05194; match to
FT                   protein family HMM PF01487; match to protein family HMM
FT                   TIGR01093"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03303"
FT                   /db_xref="GOA:Q723F8"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018508"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723F8"
FT                   /protein_id="AAT03303.1"
FT                   /translation="MNKVVVKNVTFGEGAPKICVPMVGKTVAALKEEAEMLQTIDLDVV
FT                   EWRVDFFEDVKDLAKVEAALDEIRTILPETPILFTFRSAKEGGELAVGDEFYFELNETL
FT                   ASTGKIDLVDVELFNEETDVLRLIETAHKNNVKVVMSNHDFDKTPAKEEIVSRLTRMEA
FT                   LGADLPKIAVMPKSAGDVLTLLDATNTVSEKANQPIITMSMAGTGVISRLAGEVFGSAM
FT                   TFGAAKKASAPGQIDVNELRHVLDLLHKQF"
     MNKVVVKNVT FGEGAPKICV PMVGKTVAAL KEEAEMLQTI DLDVVEWRVD FFEDVKDLAK        60
     VEAALDEIRT ILPETPILFT FRSAKEGGEL AVGDEFYFEL NETLASTGKI DLVDVELFNE       120
     ETDVLRLIET AHKNNVKVVM SNHDFDKTPA KEEIVSRLTR MEALGADLPK IAVMPKSAGD       180
     VLTLLDATNT VSEKANQPII TMSMAGTGVI SRLAGEVFGS AMTFGAAKKA SAPGQIDVNE       240
     LRHVLDLLHK QF                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page