(data stored in ACNUC10821 zone)

EMBL: AE017262.AROE-1

AE017262.AROE-1      Location/Qualifiers
FT   CDS             535630..536505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE-1"
FT                   /locus_tag="LMOf2365_0520"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="identified by similarity to SP:P54374; match to
FT                   protein family HMM PF01488; match to protein family HMM
FT                   TIGR00507"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03302"
FT                   /db_xref="GOA:Q723F9"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723F9"
FT                   /protein_id="AAT03302.1"
FT                   /translation="MTNKITERITGHTELIGLIATPIRHSLSPTMHNEAFAKLGLDYVY
FT                   LAFEVGDKELKDVVQGFRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTVVNDD
FT                   GVLTGHITDGTGYMRALKEAGHDIIGKKMTICGAGGAATAICIQAALDGVKEISIFNRK
FT                   DDFYANAEKTVEKINSKTDCKAQLFDIEDHEQLRKEIAESVIFTNATGVGMKPFEGETL
FT                   LPSADMLRPELIVSDVVYKPTKTRLLEIAEEQGCQTLNGLGMMLWQGAKAFEIWTHKEM
FT                   PVDYIKEILF"
     MTNKITERIT GHTELIGLIA TPIRHSLSPT MHNEAFAKLG LDYVYLAFEV GDKELKDVVQ        60
     GFRAMNLRGW NVSMPNKTNI HKYLDKLSPA AELVGAVNTV VNDDGVLTGH ITDGTGYMRA       120
     LKEAGHDIIG KKMTICGAGG AATAICIQAA LDGVKEISIF NRKDDFYANA EKTVEKINSK       180
     TDCKAQLFDI EDHEQLRKEI AESVIFTNAT GVGMKPFEGE TLLPSADMLR PELIVSDVVY       240
     KPTKTRLLEI AEEQGCQTLN GLGMMLWQGA KAFEIWTHKE MPVDYIKEIL F                291
//

If you have problems or comments...

PBIL Back to PBIL home page