(data stored in ACNUC10821 zone)

EMBL: AE017262.ATPA-1

AE017262.ATPA-1      Location/Qualifiers
FT   CDS             108557..110053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA-1"
FT                   /locus_tag="LMOf2365_0107"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM TIGR00962"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02895"
FT                   /db_xref="GOA:Q724W6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724W6"
FT                   /protein_id="AAT02895.1"
FT                   /translation="MKTIHFDMNKYETHVDLEYLKEHGRVEKISDGVIFCSGLENAALH
FT                   QAVLIDERHRGVILELNEEFVGIGLIDKTNDILEGMHVGVSGKFIEVDLFEEMAGRVID
FT                   TTGKMLYEESEEKPTATSPLFCVTPAIMTIDSVTRPLNTGLAVIDSITPIGRGQRQLIL
FT                   GNRQSGKTQIAVDTIINQHDQNVHCIYVAIGLKAAYIAEVIETLRNHGAMEYSTVVATA
FT                   ASDSLTAQYLTPYAGMAVAEALRDQGKDVLIILDDLTKHADAYRAITLLFNRPPGREAY
FT                   PGDSFYIHSSLLERAVQMNEEHGGGSITAIPMIETLSDDVTAYIPTNVISITDGQLFLK
FT                   SDLFNRGQKPAVDVGVSVSRIGGDAQHPIIRKLSKNLTLILSQFEELKELLDFGNALDD
FT                   GSMKMVSDGRLLTELFKQKILSPLSVTELIVILYAFQNGFLTKIPPANIQTFKDLLLEK
FT                   AHMHKDFESFSAQIETINELNESHIEMLEEIIREAGRLFS"
     MKTIHFDMNK YETHVDLEYL KEHGRVEKIS DGVIFCSGLE NAALHQAVLI DERHRGVILE        60
     LNEEFVGIGL IDKTNDILEG MHVGVSGKFI EVDLFEEMAG RVIDTTGKML YEESEEKPTA       120
     TSPLFCVTPA IMTIDSVTRP LNTGLAVIDS ITPIGRGQRQ LILGNRQSGK TQIAVDTIIN       180
     QHDQNVHCIY VAIGLKAAYI AEVIETLRNH GAMEYSTVVA TAASDSLTAQ YLTPYAGMAV       240
     AEALRDQGKD VLIILDDLTK HADAYRAITL LFNRPPGREA YPGDSFYIHS SLLERAVQMN       300
     EEHGGGSITA IPMIETLSDD VTAYIPTNVI SITDGQLFLK SDLFNRGQKP AVDVGVSVSR       360
     IGGDAQHPII RKLSKNLTLI LSQFEELKEL LDFGNALDDG SMKMVSDGRL LTELFKQKIL       420
     SPLSVTELIV ILYAFQNGFL TKIPPANIQT FKDLLLEKAH MHKDFESFSA QIETINELNE       480
     SHIEMLEEII REAGRLFS                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page