(data stored in ACNUC10821 zone)

EMBL: AE017262.BGLH-1

AE017262.BGLH-1      Location/Qualifiers
FT   CDS             complement(356218..357633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglH-1"
FT                   /locus_tag="LMOf2365_0337"
FT                   /product="beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="identified by similarity to SP:P40740; match to
FT                   protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03123"
FT                   /protein_id="AAT03123.1"
FT                   /translation="MHTNTGFPANFLWGGAAAANQFEGAYNVDGKGLSVQDVTPKGGFG
FT                   HITDGPTPDNLKLEGIDFYHRYKDDVKLFAEMGFKVFRTSIAWSRIFPNGDETEPNEAG
FT                   LQFYDDLFDELLAHNIEPLITLSHYETPLHLSKTYDGWVNRKMIDFYENYVRTVFNRYK
FT                   GKVKYWLTFNEINSILHAPFMSGGISTSPDKLSQKDLYQAVHHELVASALATKIGHEIM
FT                   PEAQIGCMVLAMPTYPLTSNPDDIIAVMEAERKNYFFSDVHVRGTYPGYMKRYFRENNI
FT                   ELDVTEEDLEILKNTVDFISFSYYMSTTETADESKRKAGAGNILGGVQNPYLEASEWGW
FT                   QIDPQGLRVVLNEFWDRYQKPLFIVENGLGAIDQLEKDENGNYTVNDDYRINYLSAHLS
FT                   QVKEAIKDGVDLMGYTSWGCIDLVSASTAEMKKRYGFIYVDRNNDGTGTLNRYKKKSFG
FT                   WYKNVIATNGEDL"
     MHTNTGFPAN FLWGGAAAAN QFEGAYNVDG KGLSVQDVTP KGGFGHITDG PTPDNLKLEG        60
     IDFYHRYKDD VKLFAEMGFK VFRTSIAWSR IFPNGDETEP NEAGLQFYDD LFDELLAHNI       120
     EPLITLSHYE TPLHLSKTYD GWVNRKMIDF YENYVRTVFN RYKGKVKYWL TFNEINSILH       180
     APFMSGGIST SPDKLSQKDL YQAVHHELVA SALATKIGHE IMPEAQIGCM VLAMPTYPLT       240
     SNPDDIIAVM EAERKNYFFS DVHVRGTYPG YMKRYFRENN IELDVTEEDL EILKNTVDFI       300
     SFSYYMSTTE TADESKRKAG AGNILGGVQN PYLEASEWGW QIDPQGLRVV LNEFWDRYQK       360
     PLFIVENGLG AIDQLEKDEN GNYTVNDDYR INYLSAHLSQ VKEAIKDGVD LMGYTSWGCI       420
     DLVSASTAEM KKRYGFIYVD RNNDGTGTLN RYKKKSFGWY KNVIATNGED L                471
//

If you have problems or comments...

PBIL Back to PBIL home page