(data stored in ACNUC10821 zone)

EMBL: AE017262.CADA

AE017262.CADA        Location/Qualifiers
FT   CDS             687891..689771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadA"
FT                   /locus_tag="LMOf2365_0672"
FT                   /product="cadmium-translocating P-type ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01512; match to protein family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0672"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03453"
FT                   /protein_id="AAT03453.1"
FT                   /translation="MKEWMKQNWQFITTGISGILIVIGCLVGSDVGDFWTAVIFLSAFV
FT                   IGGFEQAKEGIQATIKTKKLNVELLMILAATGASIIGYWFEGAILIFIFSVSGALETYT
FT                   TNKSKREITKLMAFQPERAFRLLPNGDLEEVAAKELQLDDMVFVRPGESVPIDGVIVRG
FT                   STTLNEAAINGESVPATKTVGADVFGGTVNVSSAITVKVTQTFDNTIFSKIIRLVESAQ
FT                   SEPSKTARFIERFEDAYVKAVLLFVLVMMFLPHFALGWSWNETFYRAMVLLTVASPCAL
FT                   VASVTPATLAAISNGARHGILFKGGVHLENLRGVKAVAFDKTGTLTNGTPELTDRLFAE
FT                   NVDKQQVINVVGAMERQSLHPLAAAITQDLEAEITEKLTEIEVTDVAGWGVQAIYQEEN
FT                   WQVGKAGFVGKEAAAAFSNGAFERLAGEGKTIVYVAKDGVIQAMFALKDTCRPEAIRTI
FT                   KALQAKGIKTIMVTGDNEQTGAAIQAELGMDYVVSGCLPEKKVDVLKELSVTYGSVAMV
FT                   GDGINDAPALAHAAVGIAMGEGTDIAMETADVVLMKNDLEKIPYAYNLSERLHWITWQN
FT                   ICFAIAVILVLITANVFQLINLPFGVVGHEGSTILVILNGLRLLRSNRKK"
     MKEWMKQNWQ FITTGISGIL IVIGCLVGSD VGDFWTAVIF LSAFVIGGFE QAKEGIQATI        60
     KTKKLNVELL MILAATGASI IGYWFEGAIL IFIFSVSGAL ETYTTNKSKR EITKLMAFQP       120
     ERAFRLLPNG DLEEVAAKEL QLDDMVFVRP GESVPIDGVI VRGSTTLNEA AINGESVPAT       180
     KTVGADVFGG TVNVSSAITV KVTQTFDNTI FSKIIRLVES AQSEPSKTAR FIERFEDAYV       240
     KAVLLFVLVM MFLPHFALGW SWNETFYRAM VLLTVASPCA LVASVTPATL AAISNGARHG       300
     ILFKGGVHLE NLRGVKAVAF DKTGTLTNGT PELTDRLFAE NVDKQQVINV VGAMERQSLH       360
     PLAAAITQDL EAEITEKLTE IEVTDVAGWG VQAIYQEENW QVGKAGFVGK EAAAAFSNGA       420
     FERLAGEGKT IVYVAKDGVI QAMFALKDTC RPEAIRTIKA LQAKGIKTIM VTGDNEQTGA       480
     AIQAELGMDY VVSGCLPEKK VDVLKELSVT YGSVAMVGDG INDAPALAHA AVGIAMGEGT       540
     DIAMETADVV LMKNDLEKIP YAYNLSERLH WITWQNICFA IAVILVLITA NVFQLINLPF       600
     GVVGHEGSTI LVILNGLRLL RSNRKK                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page