(data stored in ACNUC10821 zone)

EMBL: AE017262.CHER

AE017262.CHER        Location/Qualifiers
FT   CDS             732970..733758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="LMOf2365_0719"
FT                   /product="chemotaxis protein methyltransferase CheR"
FT                   /EC_number="2.1.1.80"
FT                   /note="identified by similarity to SP:P31105; match to
FT                   protein family HMM PF01739; match to protein family HMM
FT                   PF03705"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0719"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03500"
FT                   /protein_id="AAT03500.1"
FT                   /translation="MIPDLEKDYLYFTRVVKRDLGLDLALYKETQMKRRILSFIVKKQY
FT                   ITFGEFFKHLKKDAVLLDEFISLITINVSSFFRNRNRWDALEKQVLPRLLEDSRGKLRV
FT                   WSAACSSGEEPYSLAMMMERSVGTRHYDILATDLEPAILKRAVIGEYQSRQMEELTEQE
FT                   RHTAFVEKGDTYQILPKYRKSIRFRRHDLLTDYYEKGFDLIVCRNVLIYFTAEGKHQAY
FT                   QKFAESLRRGGVLFIGGSEQILNPADYGLATLNNFFYIKT"
     MIPDLEKDYL YFTRVVKRDL GLDLALYKET QMKRRILSFI VKKQYITFGE FFKHLKKDAV        60
     LLDEFISLIT INVSSFFRNR NRWDALEKQV LPRLLEDSRG KLRVWSAACS SGEEPYSLAM       120
     MMERSVGTRH YDILATDLEP AILKRAVIGE YQSRQMEELT EQERHTAFVE KGDTYQILPK       180
     YRKSIRFRRH DLLTDYYEKG FDLIVCRNVL IYFTAEGKHQ AYQKFAESLR RGGVLFIGGS       240
     EQILNPADYG LATLNNFFYI KT                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page