(data stored in ACNUC10821 zone)

EMBL: AE017262.CHIB

AE017262.CHIB        Location/Qualifiers
FT   CDS             121757..124039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chiB"
FT                   /locus_tag="LMOf2365_0123"
FT                   /product="chitinase B"
FT                   /EC_number="3.2.1.14"
FT                   /note="identified by similarity to GP:2696017; match to
FT                   protein family HMM PF00041; match to protein family HMM
FT                   PF00704; match to protein family HMM PF02839"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02911"
FT                   /protein_id="AAT02911.1"
FT                   /translation="MNKKMKKLFSITSVVLLVLSLVVVSIGAEPKRAKAAENVPQYRNV
FT                   MYYGDWSIWGGEGNFYPKDIPADQLTHLNFAFLDFNSNGDLVFTDKDAAVGAPVGQEGV
FT                   QWGGANAGVLNAIQDLRAQNPNLKIGVSVGGWSKSGDFSTVAADPTKRANFVKNVMKFV
FT                   KYTNMDFVDLDWEYPASVRDADLVDNKNDEGTPNAKPADKQNFITLLQDLRTALDKQGV
FT                   DINKKYELSVALPAAKSTLENGIDVANLFKVVDFANVMTYDLNGAWTPNSAHHTALYGN
FT                   PKDPNYDSGFSVDQTVKYLKEKGAVSNKIVVGAAFYTRGWNKVAAGTDTALPGLFQAAE
FT                   KTNKDADGSLTYGANNENPIKTGDGGRAGGVWAYRSIDALKAKTPTLKEYWDDTAKAPY
FT                   LYSKETGEFYTYDNTRSIGYKAQYVKDNNLGGMISWMQSQDKTTTSTKRDELTKAIKSG
FT                   LFGTNAIPQNAITYANLNVVATVKPYSENGVGYEITITNNEKADETNEVLKSTELSFET
FT                   VKLPKFYIPVKAGETLTAGDYKAGTVTTSGGNTVVDLASVYDAQQIPQGASYTFRLKSS
FT                   ASSVDVANISKIDLTQRMVKSSVEFGKQTIFGGGTVVPDPSDTEAPTVPKALTSSNVTD
FT                   KSATLTWTASTDNKAVAGYKVYRNGTEVGSVSGTTFTDSGLTAKTAYSYTVKAYDAAGN
FT                   FSAASSALTVTTLDAATPPATPAWDAAKTYNKGDRVSYKGKTYEAQWWTQGNEPGAEQW
FT                   GPWLLIN"
     MNKKMKKLFS ITSVVLLVLS LVVVSIGAEP KRAKAAENVP QYRNVMYYGD WSIWGGEGNF        60
     YPKDIPADQL THLNFAFLDF NSNGDLVFTD KDAAVGAPVG QEGVQWGGAN AGVLNAIQDL       120
     RAQNPNLKIG VSVGGWSKSG DFSTVAADPT KRANFVKNVM KFVKYTNMDF VDLDWEYPAS       180
     VRDADLVDNK NDEGTPNAKP ADKQNFITLL QDLRTALDKQ GVDINKKYEL SVALPAAKST       240
     LENGIDVANL FKVVDFANVM TYDLNGAWTP NSAHHTALYG NPKDPNYDSG FSVDQTVKYL       300
     KEKGAVSNKI VVGAAFYTRG WNKVAAGTDT ALPGLFQAAE KTNKDADGSL TYGANNENPI       360
     KTGDGGRAGG VWAYRSIDAL KAKTPTLKEY WDDTAKAPYL YSKETGEFYT YDNTRSIGYK       420
     AQYVKDNNLG GMISWMQSQD KTTTSTKRDE LTKAIKSGLF GTNAIPQNAI TYANLNVVAT       480
     VKPYSENGVG YEITITNNEK ADETNEVLKS TELSFETVKL PKFYIPVKAG ETLTAGDYKA       540
     GTVTTSGGNT VVDLASVYDA QQIPQGASYT FRLKSSASSV DVANISKIDL TQRMVKSSVE       600
     FGKQTIFGGG TVVPDPSDTE APTVPKALTS SNVTDKSATL TWTASTDNKA VAGYKVYRNG       660
     TEVGSVSGTT FTDSGLTAKT AYSYTVKAYD AAGNFSAASS ALTVTTLDAA TPPATPAWDA       720
     AKTYNKGDRV SYKGKTYEAQ WWTQGNEPGA EQWGPWLLIN                             760
//

If you have problems or comments...

PBIL Back to PBIL home page