(data stored in ACNUC10821 zone)

EMBL: AE017262.DNAN

AE017262.DNAN        Location/Qualifiers
FT   CDS             1868..3013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="LMOf2365_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by similarity to SP:P05649; match to
FT                   protein family HMM PF00712; match to protein family HMM
FT                   PF02767; match to protein family HMM PF02768; match to
FT                   protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02792"
FT                   /protein_id="AAT02792.1"
FT                   /translation="MKFVIERDRLVQAVNEVTRAISARTTIPILTGIKIVVNDEGVTLT
FT                   GSDSDISIEAFIPLIENDEVIVEVESFGGIVLQSKYFGDIVRRLPEENVEIEVTSNYQT
FT                   NISSGQASFTLNGLDPMEYPKLPEVTDGKTIKIPINVLKNIVRQTVFAVSAIEVRPVLT
FT                   GVNWIIKENKLSAVATDSHRLALREIPLETDIDEEYNIVIPGKSLSELNKLLDDASESI
FT                   EMTLANNQILFKLKDLLFYSRLLEGSYPDTSRLIPTDTKSELVINSKAFLQAIDRASLL
FT                   ARENRNNVIKLMTLENGQVEVSSNSPEVGNVSENVFSQSFTGEEIKISFNGKYMMDALR
FT                   AFEGDDIQISFSGTMRPFVLRPKDAANPNEILQLITPVRTY"
     MKFVIERDRL VQAVNEVTRA ISARTTIPIL TGIKIVVNDE GVTLTGSDSD ISIEAFIPLI        60
     ENDEVIVEVE SFGGIVLQSK YFGDIVRRLP EENVEIEVTS NYQTNISSGQ ASFTLNGLDP       120
     MEYPKLPEVT DGKTIKIPIN VLKNIVRQTV FAVSAIEVRP VLTGVNWIIK ENKLSAVATD       180
     SHRLALREIP LETDIDEEYN IVIPGKSLSE LNKLLDDASE SIEMTLANNQ ILFKLKDLLF       240
     YSRLLEGSYP DTSRLIPTDT KSELVINSKA FLQAIDRASL LARENRNNVI KLMTLENGQV       300
     EVSSNSPEVG NVSENVFSQS FTGEEIKISF NGKYMMDALR AFEGDDIQIS FSGTMRPFVL       360
     RPKDAANPNE ILQLITPVRT Y                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page