(data stored in ACNUC10821 zone)

EMBL: AE017262.FLGC

AE017262.FLGC        Location/Qualifiers
FT   CDS             757483..757893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="LMOf2365_0747"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="identified by similarity to SP:P24501; match to
FT                   protein family HMM PF06429; match to protein family HMM
FT                   TIGR01395"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0747"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03528"
FT                   /protein_id="AAT03528.1"
FT                   /translation="MFEGINTSGSALNAAKQWMEVSSNNIANADSSAAPGETPFLRKRV
FT                   VLSEITPFETALTGTKGVKVSEISSDTGSVKRVYDPTHPNANEAGYVNYANVDMTAEMT
FT                   NLMVGQKMYAANTSALQANEKMMEKDLEIGKV"
     MFEGINTSGS ALNAAKQWME VSSNNIANAD SSAAPGETPF LRKRVVLSEI TPFETALTGT        60
     KGVKVSEISS DTGSVKRVYD PTHPNANEAG YVNYANVDMT AEMTNLMVGQ KMYAANTSAL       120
     QANEKMMEKD LEIGKV                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page