(data stored in ACNUC10821 zone)

EMBL: AE017262.FOLB

AE017262.FOLB        Location/Qualifiers
FT   CDS             238755..239129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="LMOf2365_0237"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="identified by match to protein family HMM PF02152;
FT                   match to protein family HMM TIGR00525; match to protein
FT                   family HMM TIGR00526"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03024"
FT                   /protein_id="AAT03024.1"
FT                   /translation="MDKIYLNELVFYGYHGVLAEETKLGQTFRVSLILGLSTKKAGISD
FT                   SVDDTVSYAEVYETVKEIVEGTPFKLIEALAEKIATEVLTGYPLLEEVTVKLIKPNPPI
FT                   PGHYDSVAVEIERKRSDLNG"
     MDKIYLNELV FYGYHGVLAE ETKLGQTFRV SLILGLSTKK AGISDSVDDT VSYAEVYETV        60
     KEIVEGTPFK LIEALAEKIA TEVLTGYPLL EEVTVKLIKP NPPIPGHYDS VAVEIERKRS       120
     DLNG                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page