(data stored in ACNUC10821 zone)

EMBL: AE017262.FOLK

AE017262.FOLK        Location/Qualifiers
FT   CDS             239122..239601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="LMOf2365_0238"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="identified by match to protein family HMM PF01288;
FT                   match to protein family HMM TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03025"
FT                   /protein_id="AAT03025.1"
FT                   /translation="MAKAFLSIGTNLGERLENLNDALSGLAASDKIKITNVSSVYETDA
FT                   VGYEDQAAFLNIAVEIETDFPPVDLLDFCLALELELGRVRLFKWGPRLIDIDVLLYDDV
FT                   KIDTEKLKIPHPYMKERAFVLIPLIEISPEKSNLVDNPAILEEQGVRKIKNQVNW"
     MAKAFLSIGT NLGERLENLN DALSGLAASD KIKITNVSSV YETDAVGYED QAAFLNIAVE        60
     IETDFPPVDL LDFCLALELE LGRVRLFKWG PRLIDIDVLL YDDVKIDTEK LKIPHPYMKE       120
     RAFVLIPLIE ISPEKSNLVD NPAILEEQGV RKIKNQVNW                              159
//

If you have problems or comments...

PBIL Back to PBIL home page