(data stored in ACNUC10821 zone)

EMBL: AE017262.FOLP

AE017262.FOLP        Location/Qualifiers
FT   CDS             237674..238741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="LMOf2365_0236"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03023"
FT                   /protein_id="AAT03023.1"
FT                   /translation="MKRKTEKSHETLTKITAYPPKTWLIYSHKLTTSKTFSFFSPLFRM
FT                   KIPNSLFDRCGLLPFPHRFFCALKSLNSAIINLGKRCLGLKKWKRDHLGMVMGILNVTP
FT                   DSFSDGGKYMQVEEAVARALQMAEDGAAIIDVGGISTRPGFSEVTPEEELNRIIPVIKA
FT                   VRTKLPDIWISVDTWRAEVAEKAILAGANMINDQWGAKKEPKIAEVAAKYNVPICLMHN
FT                   RENTQYDNFLEDVKKDLLESVAIAKAASVPDEHIILDPGFGFVKTPAQNLEVLRRIDEI
FT                   VALGYEVLLGTSRKSTIGLVLGTTPEDRMEGTGATTVYGFSKGCTITRVHDVLPIARMV
FT                   RMTDAITGKLDITKL"
     MKRKTEKSHE TLTKITAYPP KTWLIYSHKL TTSKTFSFFS PLFRMKIPNS LFDRCGLLPF        60
     PHRFFCALKS LNSAIINLGK RCLGLKKWKR DHLGMVMGIL NVTPDSFSDG GKYMQVEEAV       120
     ARALQMAEDG AAIIDVGGIS TRPGFSEVTP EEELNRIIPV IKAVRTKLPD IWISVDTWRA       180
     EVAEKAILAG ANMINDQWGA KKEPKIAEVA AKYNVPICLM HNRENTQYDN FLEDVKKDLL       240
     ESVAIAKAAS VPDEHIILDP GFGFVKTPAQ NLEVLRRIDE IVALGYEVLL GTSRKSTIGL       300
     VLGTTPEDRM EGTGATTVYG FSKGCTITRV HDVLPIARMV RMTDAITGKL DITKL            355
//

If you have problems or comments...

PBIL Back to PBIL home page